SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSOIDT00013664001 from Oikopleura dioica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSOIDT00013664001
Domain Number 1 Region: 531-866
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.78e-54
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000245
Further Details:      
 
Domain Number 2 Region: 874-1002
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00000000000000237
Family Ricin B-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSOIDT00013664001
Sequence length 1030
Sequence
MDTKIELEDLMRRERRNWIKIDGLVDMMNDKNCPELEADFRRLKFFLRKVKNTDDYEFYF
NELCCETNQDTVKNFKTDNIENDVSATNPKRDEIPQNSVKVRTEKTSTGTVDLTFQTSSA
SVEETAQKLKEKPTENNKKYIRYFTTSESESEMKTMPKPKRTKKDETNRRRVPGRPKKKS
NLITPRNSKEHFASKFGDNMPPLEDIPNSRDSISNSDKPAFVSPKRMITMQSTSGAEVEQ
DQVNPSVYESAKEILSSQQTQSPASAKVKRKRGRPKGSKSTPKSTTPKTDSTKSKRIAKI
QLEKEGKELSDDDRDSISFEDFSTQNKSHLHNNRSITMKVVHIQKKHLKRVIIVIFVFSC
VLSFYLHSQEPASSKLHKKSEKKSKKHHSKVKEERVFQEDAVEDSLDAPSFDDASKNEIP
DFQSFNEDEEKSDEEIQLEKESYGDGFKKWRLEELDPADYVDWPVLTSRPGNYEARPEIP
QVGSKGHEGTNTGEGGLSPIRLTSEDQTKVTAALGLWGFNMVASDKVNMDRVPADLRMEE
CKRWDYPDKLPAVSVILVFHNEGFSTLLRTVHSIVNYSPPEMLHEVVMLDDGSTREYITN
GTIDRYIERWDGLVKIFHNEKREGLIRARTIGGKHSTGSVLVFLDAHCEVEPNWLPPLIT
PIAKNYKVSSLPMIDAIDGNTYVFEPQQGGDENNLARGAWDWNFDWKRIPLNQREKARRA
TITEPFRSPAMAGGLFAISRKWFTELGWYDDKLEIWGGENFELSYKLWQCGGELLFVPCS
RVGHIYRMPGWGGNGTPDELKGKNFIAVNYNRVIETWWDDNYKKYYYERRPENKNVDVGD
LTAVLAIKEKLQCKDFSWYMREIAYDIPKYWPMVMPKNQAWGILKNEGTGLCPNSRNSKQ
GESVEVDSKCNVRLSLTWREDIRIGDGPVKNTAMCWDDSMGANKRISYWSCHNGHGNQLY
KYLPETKQIFHPAHRMCVESVDDYLVFAACNDEKASQRWTWSETNGEALERAMKSKFQPG
DDPPELDYIQ
Download sequence
Identical sequences E4WYX1
GSOIDT00013664001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]