SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSOIDT00015494001 from Oikopleura dioica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSOIDT00015494001
Domain Number 1 Region: 83-175
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000251
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 160-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000649
Family EGF-type module 0.032
Further Details:      
 
Weak hits

Sequence:  GSOIDT00015494001
Domain Number - Region: 262-338
Classification Level Classification E-value
Superfamily Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain 0.0693
Family Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSOIDT00015494001
Sequence length 722
Sequence
MKLQYIFFYCTSGVLSQRKRAKGRASFAQDITDADYSAIFAPPSGSMLEQMIAMSMGSTS
TRPVRKNKREKKKKTSKTPAFPGKCSKFKFSCHENAECRNVADGYICSCPEGFVGDGKTA
CEDMNECAASKNPCGTNKKCVNTAGSYYCSCESGFEAVRNKCRDINECTSGAHACVANAY
CNNLYGDYECICPSGFEGNGKNQLANAKNTGCSARSTTRTTTTTTTTTTSTTTKRANEEF
QIFEQFSDQDLISYEYGDGFGFVDGGELSAQMLDSFDVEHGANRAENDYDYMTSLQSFAE
LLYSNDKTLDARSGDFSDKLNQYWATMNRQWGKVQQAQTASSGKVNSNFSPSDGEGGKIG
VSKGSNWSAAWKDAPWNVDAGLSAVADSWGADHGVGFSAAGNSWLGSNFDSSWELGGGTG
QLASIDGAVDTSFDTNFDATGLGAGAIPGTADANYYSSYRWHQGIDARRNAASSEVHDPA
KLKCHACNVQRELAWDKDDGTFKLIDPADPSKADKTGENIFAACSATLNQVSCEYSAGTC
FIEERRTWGYVTQVRAGCKQAQACYMQKYQNFLIKAGRQCWPGDNAGMADKVGRRPYDVA
LYEWPNTNLGWITNIIYGGAAANGIGTTFTSSDAQTGLFVDADYSDFLGVRAPVDYKNGL
KESSFCTQCCNSEHNCNFDWQPRTEADWERSFAWNYDTSSMTGNAFGTGVEQQPSEVDPV
IT
Download sequence
Identical sequences E4XMU7
GSOIDT00015494001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]