SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSOIDT00016959001 from Oikopleura dioica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSOIDT00016959001
Domain Number 1 Region: 491-536
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000419
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 2 Region: 739-785
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000051
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 684-735
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000183
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 4 Region: 791-837
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000249
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 5 Region: 587-636
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000275
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 929-978
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000101
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 7 Region: 636-684
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000126
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 8 Region: 87-131
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000183
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 9 Region: 841-864
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000068
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Weak hits

Sequence:  GSOIDT00016959001
Domain Number - Region: 1072-1216
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00306
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.028
Further Details:      
 
Domain Number - Region: 877-927
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00314
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSOIDT00016959001
Sequence length 1268
Sequence
MIGSGCIGSPIETRQCNMQNCPTPPPTTTRPAATPANKYQGECKDEETWCSGIAQSQCRS
SIQIAARCRKSCGLCIAAISAPTVGGGKWQPWSPWTACSGSCKGGFSKSRERRCGEYGRK
CDGKSSETSPCSIGFDCYVDEYFKCSDKSDNCNEYALEGRCFDSQFKDWMSNNCEASCRL
CMGLNIQWSEWTSCKVPGGVCGNGERKRSHDVTTIVETCNIPCASKASSTKADCKDKHPY
CPNLTSHCESKSVQSACQFTCNSCPADIPVDNTCKDKNDYVCSQSANCQKEEFQYLCPKT
CKTCMKAASQSVDNSSVSASNSASNCKDLSPACKGAGIKAQCSNNLWLKKNCRETCETCG
VSEEAMTTRAPLTTMSPVCIDKSRDCPRWKSMCQSQREILEVKCPVTCGICVPETTKAPI
TTTTTTKVATSPKTMNCLDGPLCSHYAGNWEINCRDSAEFRDTCPTLCKIDICAEYWDED
LIPENTDELEKRWRAWQEWGACSVSCGGGERSRSRTCKAPVYKPCTYGSESDTGLCNKMS
CTTTQAILTTPKPTVCEDKPFCDGLGSNFCSDPNIASGCPKMCDNCQPYFGEWAEWSTCT
ATCRGSGARSRSRECIQVNEDKPGACEGDASESDDCPNLDICYDEWTKWTDCDADCGNNS
TQTRQRVCSEPEDCEWVDKESQECAGSCVFDDWSEWSDCSATCGNATATRSRDCPVEGAC
GEESIETMDCEVLPCAEYLDWSEWSECSVSCGGGEMRRERNCTEVDECSSLGAPSAIMAC
NEEGCPVVVEWGEWTTYSPCSESCGVSFKTRSHACVNGEIGSEGCPLSDYVEVSPCVYTA
CETWSEWSACSAECGQGHRERVRGEDVETINCYAGLCSDVGAWTEWAITENNCEITCGGY
KLRERQCINGIPEQGGCQGDATETIECEPCGEWNVWTSWSDCNKSCHTDGVKGIRSRSRK
CMGGRCKAGDAEEIISCVTPACDFKPTLRTTTEWETTSSTTGTTNNPTTTTASQVTSTVA
VTTSKADTTTAEITETPVLEAELDRLFDSFVFGEPSDCNIAELSEEPNRILSSSNRESFE
AEKAMSEEGGWCASLESSDNWLVIDYAEDVTFVGVKFNIVEEVINNGGFMGTETQSMRHM
ASEVKVEYNQDGQWTPIQSIDTAVLTAFEERHLSDPFGNPSVERLWTKKIKTDRIRLSVV
ATFGRNECLNVRILTCAPAIQASFGLPPFASLPSGNPFLSNEIDEEDVFSLSDQNDFQRI
EIDGSGDF
Download sequence
Identical sequences E4XPI7
GSOIDT00016959001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]