SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSOIDT00016960001 from Oikopleura dioica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSOIDT00016960001
Domain Number 1 Region: 236-415
Classification Level Classification E-value
Superfamily MIR domain 1.83e-31
Family MIR domain 0.0025
Further Details:      
 
Domain Number 2 Region: 1115-1232
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-22
Family SPRY domain 0.035
Further Details:      
 
Domain Number 3 Region: 680-837
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000158
Family Galectin (animal S-lectin) 0.068
Further Details:      
 
Domain Number 4 Region: 4005-4079
Classification Level Classification E-value
Superfamily EF-hand 0.0000000765
Family Polcalcin 0.074
Further Details:      
 
Domain Number 5 Region: 120-215
Classification Level Classification E-value
Superfamily MIR domain 0.0000000915
Family MIR domain 0.016
Further Details:      
 
Domain Number 6 Region: 2148-2237
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000889
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 
Weak hits

Sequence:  GSOIDT00016960001
Domain Number - Region: 477-598
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00275
Family IP3 receptor type 1 binding core, domain 2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSOIDT00016960001
Sequence length 4968
Sequence
MTELEEDDIFLRTDDKVYFQFGQIITFILYFQCTKTHENKQDTTKICLAAGSFGTRICYA
EKTQFSPVEGENVGPPNTPECVFVINQALSLRALHETLTHAKENNRPNQTSKTGPSHSKT
LLYGNAVQLLHQTSGLYLCVLPTSQCTTDKLAFDVGLGDNPNDEAAWWTVSCASKNRSEG
EKVRVSDDIILSSVSSERYLHLSNKNDVKVIEDDFQRSLWMIGPIQSEVKQGYVCGGDVL
RLFHGRNSDDCLCNLDVNDVNIDPIRTAIYYEGGKVSIRARSLWRVELTRIKWFGSHLHF
GQQFRLRHMTSGKFLMMRADRNLFIAEKDEHDWTDEASIFCFRQNKDKVEVSGEYEPESM
GTEEIKYSESLVVLQHCASGLWVTYQAQENSAKIGKQIRRAIAHPEGHMDDAFAVGRSQS
TEAKTAMVMLTTVTTIKKFLTHMIKNFQKIKDLKAAANAVHFVPKGKANLEVPLDAMELL
IQDCLVYFHPDEGETDEEKQQIERLQRCQQDLFQAEGIVDLLLKVIDKLTVYTATQHLQY
LHKDQVERLEVLLVNVYKLLAGIIKKNRANCAKFSKNLDWLIGQLDARQNASAGILAVLS
AVLDDSTEVLNMVKERHIVSIISLLERHGRNPLVLDVLQSLCVCNNIAVRSNQNLICNHL
LSDRNLLLQTTMVNQIVSIRPNLFVGYGERSAQYRKWYFEVQVLQMDECSLSQATHLRVG
WANTSGFAAYPGAGDGFGTCGVGDDLYSFGFDGLSLWTGHRSKYIKQGKVELFKKCDIIS
CCLDLSAPSMSFRKNGKPIHGMFERFNLEGMFFPCVSMSSGVVVKFLLGGKNGEFTFMPP
PGYAPAHEALLPERTLSVETVRGHYGVNDNWILNGPAKTLDQAVYTPDPIETKNTELPKA
LEPMLDKIAENLHEIWAFNRIQGGWSFALVRDDQKKQNPSLTSFERLPESLRTFNMTMVE
QNLRTIIALGYHVGLADEDAEYKLRKLKLPRQYLMTNGYKPAPLDLTHVRQSDKMEELVE
LLATNSHNVWASERIKQGWTYGFELDVKNKRNFRLVPFALLDENAKQTNKNSIRELVITL
MGYGYAIEAPDERMTTSSRKDDEQSDNPRFRMFRIESAYAVRSEKWYFEFEVQTDGEMRI
GWAAPEVKADEPIGLDNLSYTFDGFNAAKWHNGQEAYGKRWRVGDVIGCLLDFDEGFISF
SLNGELMIDNQGAELAFNNIPDDIELVPVAYFDEGQQGILNLGKNPDTFKFFQMYGVQEG
FKPYCYQISYPLPIWYTKSLPSFSPIYKHDQLRTIRIQPGITTPPILRLQYKAFSSSSSR
VVDMPNFIYSRLSMPVRILETLKKAPSDRVNVFDAPEEVDQFDRDLDILKEREKEEKQAK
PKVSLGLKQILNRRGKKEEEEAELLLAAGASQKHNRLKMDVLPSMTYNLGDYEHQNLLAG
SRYVFSVRVFPGQEANNVWIGWVTPEYHSMNPSVFDDRHHIKNVTMTFGTERGEIKETIC
RSNAFLINAGMALSSQKSDKDMNAGSTSGGTIISCIVDVSSGLLKFRAGDKELDIVYQVE
AMTQLYPACFFKPSTYNCIQYELGRTKKEMPISAAMLKADRKNVEPSCAPRLKAQKMQAV
NWARMPQDCLTPIISRNRKTRDGWKVQIEKPMQFCAVFLPEENRSVDILELTEHPSLLEF
HLSTLNLYKAMCALGNFRVAHALCSYIDQQQFLYCIKSSYLDGRLREVYHDLLIDIHLGA
HANARQHTQGEFIIPLTEETKQVALYEDPEVKDPGLPGMGRFTSLRPDMRWKTANFVVPV
QQYYTEVPAFPLDLLKHHVIENLINAVSSQTSPFKMYAGGSQEHLFVPLLKVCDKLLLMQ
IFDDEDLEKLLTIIHSRYLGSKVEGYEELKYRVGEGLLQMRLCESIKLALCSLLHHLCDY
QLRHRIESLVSFAHVLAGEMQKNQRERYDEVMHSINMSAAMTAKMTKEFRSSPYDQAATI
IRFKSEDDELDSPCPTNIRHMMWNFHNDLMMHCGESIPEEDEEFEEYSMINKIKRMGKAL
YNCFSPKQEEFDDLEMVNIPIHNLQQLIAVTAVHWAEEAVIENPILVREIFALLHRQHDC
VRELCRALEKTYCISEKSKNDTMELISDLSHIRSFLAVQMGKEEETMITQDLSRIMNNCV
FYQHPNLMRALDMHTTVMDIMVNVLGASAEVGKQVSTAEVQFPKIVAVCSRFLGYFCRIS
RVNQKAMFEHLSFLLDHSIFGLDTPSMRGCTPLDVAAASLVDNNELSLQIKETHVELVIK
YLRTCGLQSSQTLLERNYPDIGWNPLEGERYLDFLKQVVFVSGESVEENANLVVRHLIRK
PECLGPALRGEGGQGLLAAMREAMEISKDPSRDTANNDAKRKIYQDEENDDEEEIHLGYC
ILSFYSSLIDLLGRCAPEQTLILQNKSEALRIRSILQSLVPLEDLVGVISLPFDLPRVEP
ITETVIQPMMNSCFAPEHKAAMLLFLDRVYGIDDVEFLLRILEDGFLNDIRAAAQLDTQQ
LHVTDMALALNRYVCSSILPIITKHVHLLAKAEHRDQLIDSALHAIYRLSQGRAMTKAQK
DFISECLCAIAGVIKPILMHNLLRKLTFDIPSLSQHVVVPIRMLTLHFERSWQYYCCPEG
WGENGVASDEERHLTMRLFWGLFEALVKNFDPNMVKWALPCLCAIGNALPPDYAVPSLVD
DGARECQLDKNGNYDPKPINTSGQRIDHRCDEFIERYSEHLHDIWASERMANGWNYDPMF
NDQTKEHPLIKPYANFSDREKDVYRNNIREAIRALQVWGWRVDRRGMHSGSGGPAEFGRR
PSMSSKPDYVVDSSKGFTPKTTDLSGITLTREFTAIADSMAENFHNIWAKKKKIELEENG
KSHPMFVPYDTLTAKEKEKYRNKAYDMLRFIQFSGFVLNKASSDDNYDARTSQERRFSFI
LLHRLGEFLELARNYVEELMVAITDQQLGDSLHFTSDSVKFFAKVVLPLIQSYFKAHQHY
YVTPKSAKNIGISACNKEKEMIVTLFCALAALMRRKVNFFGEDSEVTVDCLTNLTRCIDA
ATVIKMGPDHVKSLLVVFFNDAAVDIELVLDSIRIWHLEKKSVALRAAHCWQYATQALIP
ILTKFFNHVGDNEFGRDLLIEEMQVACYKILNALYPLGTAKNHFVPHLKTKSAFGECLAA
LANCFPVAFLEPRLNRYNTVSVYNALSIKDRQVLGLPNRIEELAPNLPTLKILLRDIEDL
AVSGARYDDAPEMIDVILPVICSYVPNWLEEGPEGKPELPNHCTEIGIKQANDTLGNVLR
LIYNNLGTEEAQWMKSIANYTQPLMAKCGSDLLYSHFLPILEKTLKKIERTAAIEEDIKS
DQKIAVGDVSDLEMMMLEDFGFISRDIYAFYPLLVRFIDKNKMDWIATKNPEAESLFWKV
SEIFVAWAKSVNFRREEQNYVVQNDIDNMSVITSDITAHKLRRHREKLKRRGEIYSWGTS
LICVAPKRLLPVGLNVCVAGEHKIVQDAKIRLLKKESEANVMYHIKEELEYMELEDEYEF
SGDDLDKRAEIIFRLARIHCHLYKIEHPEDKGRAVWEKLMSKSRKKAVVSCFRMTPLYNM
PAHKVINVFIKSYNNLWLATEDRDFANALITALTKPQKTIGQEEIKPDDPPKALSDPLFQ
IIQVQLNFFAFQTPANENIEADPLYLHYAELMARSIGPSELEGGPDQEEEEEDDEDDGNF
EDKEVEKQNLLFCQSRLHERGAAEMVLLVISASNGKLCDMVVASLDLGISLLQGGNETVQ
RKMLMHLQEKRDSKFFTSLQALMQLCNVLDLDAYEHAENKGQQTKFTIMLFRFLQLLCEG
HNEDFQNYLRTQVGNNTSVNIVISTVDYLLRLQESVSDFYWYYSSKDQIDDQGKEHFSSA
IEMAKQVFNSLTEYIQGPCFLNQSSLAHSRLWDAVVGFWHVFAQLQSKLSKDSGNSLNLL
SALLDLQQDMIVMLLSMLEGNIVNGNIGRQLLDTLIEAQQDVGLIIKYFTMFLKLSEVVE
TEKFKEIDLEGKGIITKREFHKQLESAKNYDPEEIEYVLKCIQPDENDKFNYKDFVDQFH
KPAEEIGFNFALLLTSLHEHSTNDNRLDKFLDIGKELLDYFDSNLGRIEILGKSKRIERI
YFNIQQSSLEQWEKPQIRDSKRAFIFDVIAEGGENGKMEEFVSFCENTIFEMQLAASISQ
EGDEDGDENAEQGDNEDEEHDIQRHSFWDSVKHQFRIILGNISYFFTSKFFKKAFRTLRH
TTVRDFVVFIFIVIYRAIKLFGRMLANICKFVGEWLLFYLFSSNLIDMMKENTITGIIQA
IPEPTQEGIGTRHEDDVAEEDDEEEEEEEDIEEEDAPVIGEVFGITNKNDSTAAFTTYVE
DKSWKGFGDQDFDEAARNLGMEYDETAFNQQVEAQAIRDRQRRNSEIGSANKLKSNAKQS
SWNNFDSDAGTWQTYRNPCLRPLKYTSIEETKEEISPWKLKFQVFSTAFLAFFARNYYNF
KSAALIISFLLNVILLSLRWESEEELEVDEHVISEAEVLENTLDDQEFGDQVNEVLVFSD
WMFENVNEVFNWCAFLHTILALAKLVSYYELKVPLLIFKREKDISRKLEFEGLYVSCQPD
EDDFTSMWDRLVISCPHFPMCYWDKFVKKKVLEKYGGQFERDTVSELLGLDTSVNLNISP
KERQEAENTEKQNKGPLAFITDHDWRYGLWKTGVVLTDRTFLYLLGYTAFSFAGHFNRFF
YAASLLDVAFDVKSLQTIMASVTHNGKQFMLTVGLLVCVIYLYTVVAFNFFRDYYNKGED
GEDDWKCQDMLSCFNFHLYAGLRAGGGIGDEMDPPGEDDFLARFAFDITFFFFIIVIILA
IIQGLIIDAFGELRDQVEQVKDDMESKCFICTLGKDFFDQVPHGFDTHTMQEHNLANYLF
FIMHLINKDKTEYTGQESYVWNLYQERCWDFFPVGDCFRKQNQEKGFE
Download sequence
Identical sequences E4XPI8
GSOIDT00016960001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]