SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP002966-PA|TOLL from Anopheles gambiae VectorBase AgamP3.6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP002966-PA|TOLL
Domain Number 1 Region: 218-512
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.55e-68
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 31-138
Classification Level Classification E-value
Superfamily DEATH domain 1.01e-26
Family DEATH domain, DD 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AGAP002966-PA|TOLL
Sequence length 515
Comment pathway signalling, Ser/Thr Kinase.|protein_coding|2R:30248604-30250367:-1|gene:AGAP002966
Sequence
MLCPIMSKPNGQHTEMEGKPSGLSAATTVAPLSNFVYIYDIPRMEKKRLAALLEVNNKWY
ELGEKQMGYSTVELDSTQRCCQRNNRSPAEQLLDKWGNYNHTITELFVVLSREKLYNCME
LIKRYVDSRYHVLIKESASDGRNAVANMATFSGANNNANVPNGHRAAHRLKDGAADQKVN
GGGGDGAAAAAAAATNDKSNPTNSKENSPFANELADLTSLIPKISYEELTAATDNWSERN
ILGKGGFGTVYRGNFKHTFMAIKKIDYNKVKSSEAERIQLQQSFNELRFLNSCRHDNIVP
LFGYCIEKEPCLVYQFMPGGSLDKSLFARRPASPLTWRERMNIAIGTARGLQYLHTFGDK
PFIHGDIKPGNILLNEYKQPRIGDFGLTRQGAVQDSATVVSRVYGTRPYIPKEFYDRREL
STKVDTYSFGVVLYEIGTGLRAWDERRTEKHLKDYIARAVQEQMHVTQLADQSLPMDAEA
LMCCFKLLQVGRVCTADDPKQRPDMVGVMWQLSAA
Download sequence
Identical sequences A0A0D3QDC6 Q7QD54
XP_311931.4.40869 AGAP002966-PA|TOLL

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]