SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP004070-PA|hypothetical from Anopheles gambiae VectorBase AgamP3.6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP004070-PA|hypothetical
Domain Number 1 Region: 609-697
Classification Level Classification E-value
Superfamily DEATH domain 9.71e-16
Family DEATH domain, DD 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AGAP004070-PA|hypothetical
Sequence length 709
Comment protein|protein_coding|2R:49464098-49466314:-1|gene:AGAP004070
Sequence
MSSNSSNFLVLLKTFTESLERAFAANDIEVLKADYDAARASDNDKKTALHQAFRDMLLTK
TEDIPAIERFISFAVNSCRKDMTVATMPVVLLGDIFDAVTLDRAEQIFTYVENNVAIWKE
ECFFTACKHNLLRMCNDLLRRLSRSQNTVFCGRILLFLAKFFPFSERSGLNIISEFNLEN
ITEYGMDGNEMAVDQLSGGADPEVDGEPAEENKLKIDYNLYCKFWALQDFFRNPNQCYNK
VQWKTFETHAKSVLSAFCSFKLEEHRASSTSSGPATKPSDVGGSATAAAAANNCPMEEDQ
IRESGHFFAKFLTNPKLLSLQLSDSNFRRSVLVQFLILFQYLNSTVKFKAETHVLTQAQS
DWLKETETQVYQLIEESPPNGKKFANTARHMLLREELWNSWKNEGCKEFKRPEAALEDTS
SSTAAVAGGAAAGGAATSAGSGRPPAKRPRKPLGDLIRDATKQGKFYMGNSEITRLWNLC
PDNLQACKGTDRNFLPSLETYLENPKEKQDPSFEWRALRLLARQSPHFFTLFNSPSYKVA
DYLESVRKKIQKDKLDIKLEHAIQEETAPTNAEQPEAEGEGLVGEEEHEQMDTELLKTEQ
LTPEDKNTHKTLAVTKAQLSELAPSIGRDWKKLATKLGYSADEIQYFESEHATVADQCCH
LLTLWFDDDMDASLDNLAYILEGLDMIPAADAVKQMIALLSDKVEEVSE
Download sequence
Identical sequences Q7QH59
XP_309625.4.40869 AGAP004070-PA|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]