SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP004754-PA|Caspase from Anopheles gambiae VectorBase AgamP3.6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP004754-PA|Caspase
Domain Number 1 Region: 169-422
Classification Level Classification E-value
Superfamily Caspase-like 4.49e-63
Family Caspase catalytic domain 0.0000292
Further Details:      
 
Domain Number 2 Region: 1-91
Classification Level Classification E-value
Superfamily DEATH domain 0.0000381
Family Caspase recruitment domain, CARD 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AGAP004754-PA|Caspase
Sequence length 430
Comment (Long).|protein_coding|2L:3063136-3064661:1|gene:AGAP004754
Sequence
MNNKDRFLITHNVEKLVNYTNYKQLSFECIQQKMLSPTMVSRIEGIAQDEVTRHKKLFEK
ITKRGPKAFDTLLAICQQAFPTAYLILKPNSNDNQMHSTHNPQRVRSVSCNVAPKVYSLR
SPGDVDDGKNNNFASNALVEESKCILQVYPDILPTTFSVKLSTRPAETHPKVPAYPMKGR
NRGVAFIVNVITFLKKVHPTRNGADIDGRNLISVFQQLGFVVFYYEDITMGDLKELLAQL
KESEHLSCDCFAFYILSHGDHRKGSDYIFLHDNSLLRVEDLLTEFNSVNCKRLVHKPKLF
FISICRGVQSDLGAYRLSTNTERDGMIDPGKPLPSNIATYCDMLVCYATVPGFAAHRDTN
TGSWFVESMCKIWSEHAHDTDVEILMKLVGEYASSYRTEHSALQTICTEQRGFFKQLFLN
PGYYENPVEL
Download sequence
Identical sequences Q7Q2Q0
AGAP004754-PA|Caspase AGAP004754-PA 7165.AGAP004754-PA XP_318061.4.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]