SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP004959-PA|IMD from Anopheles gambiae VectorBase AgamP3.6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP004959-PA|IMD
Domain Number 1 Region: 176-270
Classification Level Classification E-value
Superfamily DEATH domain 4.97e-18
Family DEATH domain, DD 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AGAP004959-PA|IMD
Sequence length 282
Comment pathway signalling, Immune Deficiency (Imd).|protein_coding|2L:7194668-7195587:1|gene:AGAP004959
Sequence
MVKFSNLIGTLFSKSAASKLETDAAPLPPRRKADAYGDETMAHTNTPAAAAATQNGNFPN
GVQVVPGMENLALVPGGSSQSLEPVAGEHHTATPQTVVNNVQHNTLTAPQTSISNTTGMQ
VFQIRNASNLHIGNSYTFNTAAVVDEGASTSGSLPGAGSAVKWANLRLSNTISQMMQSQD
EVDTELLDTVSRHLGYEWKSFARRLEYSEGQIDAFEADNSTLAEVSRQIYSFMLDWTRND
DDPTLGRLVTLLWNNKHKETVYYIKQVWKKRKEDKNSPERSS
Download sequence
Identical sequences Q5TS00
AGAP004959-PA|IMD XP_557597.1.40869 7165.AGAP004959-PA AGAP004959-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]