SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP011725-PA|hypothetical from Anopheles gambiae VectorBase AgamP3.6

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AGAP011725-PA|hypothetical
Domain Number - Region: 93-150
Classification Level Classification E-value
Superfamily PH domain-like 0.0134
Family Phosphotyrosine-binding domain (PTB) 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AGAP011725-PA|hypothetical
Sequence length 236
Comment protein|protein_coding|3L:32454478-32455461:-1|gene:AGAP011725
Sequence
MNHTWIAAPKHCQDASILLRQMHKLHLARCYRVALNAERKRQLDLKVLSEAVFKNSKRNY
PESVGPWFVDDRIAKQHATQISNFTVTQMNGEKLHYSTPVVKYDRRGYKPRERFFLLSNK
AVYLLDGKTYKQKHRLPLDKVDFCITNERDGIMLIRIPLELKKDKGDLILDVPDIIECCI
WILDATKNRSIINIVDTGSLSHNLVRGKTGVIEIQTGPQPSITRAKSGNLLVIAGQ
Download sequence
Identical sequences Q5TML1
AGAP011725-PA AGAP011725-PA|hypothetical XP_552525.3.40869 7165.AGAP011725-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]