SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP001015-PA|hypothetical from Anopheles gambiae VectorBase AgamP3.6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP001015-PA|hypothetical
Domain Number 1 Region: 1929-2174
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.11e-54
Family Ankyrin repeat 0.00000000942
Further Details:      
 
Domain Number 2 Region: 903-1034
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000675
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 799-842
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000393
Family EGF-type module 0.0029
Further Details:      
 
Domain Number 4 Region: 445-577
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000471
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 5 Region: 682-803
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000148
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 572-614
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000146
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 7 Region: 1216-1352
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000148
Family Growth factor receptor domain 0.0093
Further Details:      
 
Domain Number 8 Region: 145-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000719
Family EGF-type module 0.0029
Further Details:      
 
Domain Number 9 Region: 837-879
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000137
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 10 Region: 1187-1230
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000201
Family EGF-type module 0.0036
Further Details:      
 
Domain Number 11 Region: 647-689
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000214
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 12 Region: 302-348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000307
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 13 Region: 340-378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000643
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 14 Region: 607-651
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000393
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 15 Region: 1032-1072
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000714
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 16 Region: 1069-1105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000152
Family EGF-type module 0.011
Further Details:      
 
Domain Number 17 Region: 1346-1383
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000162
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 18 Region: 377-417
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000643
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 19 Region: 1540-1573
Classification Level Classification E-value
Superfamily Notch domain 0.000000131
Family Notch domain 0.0041
Further Details:      
 
Domain Number 20 Region: 1580-1613
Classification Level Classification E-value
Superfamily Notch domain 0.000000157
Family Notch domain 0.0026
Further Details:      
 
Domain Number 21 Region: 71-106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000179
Family EGF-type module 0.011
Further Details:      
 
Domain Number 22 Region: 1107-1148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000285
Family EGF-type module 0.011
Further Details:      
 
Domain Number 23 Region: 107-149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family EGF-type module 0.018
Further Details:      
 
Domain Number 24 Region: 1423-1459
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000117
Family EGF-type module 0.01
Further Details:      
 
Domain Number 25 Region: 1500-1532
Classification Level Classification E-value
Superfamily Notch domain 0.00000157
Family Notch domain 0.002
Further Details:      
 
Domain Number 26 Region: 24-68
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000268
Family EGF-type module 0.012
Further Details:      
 
Domain Number 27 Region: 420-455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000951
Family EGF-type module 0.012
Further Details:      
 
Domain Number 28 Region: 1385-1422
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000026
Family EGF-type module 0.011
Further Details:      
 
Domain Number 29 Region: 1160-1195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000328
Family EGF-type module 0.04
Further Details:      
 
Weak hits

Sequence:  AGAP001015-PA|hypothetical
Domain Number - Region: 184-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000115
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AGAP001015-PA|hypothetical
Sequence length 2800
Comment protein|protein_coding|X:19495565-19526057:-1|gene:AGAP001015
Sequence
MLGHFAELLICTSRYTGDFCDFPNPCHTAAGPRCQNGGICETTFRDGVPSFSCRCPIGYT
ASLCEIPVKNACDSSPCNNGGNCKLKTLDDYTCICATGYSGKHCDKQNLCASSPCRNGGT
CTLSPNGHVKCICPKGFRGMYCADDIDECLKNPCENNGKCVNTHGSYQCMCEPGYTGKNC
ESGYIPCSPSPCQNGGTCKQSTKYSYECKCPPGTSILLHRVNPAEAPAGRRAINNQTITF
IINNQPEGLPRTANSCFNQRTIGLSSTTKTVMMVSCVLNALFNMIEKQSGSNSFQGKNCE
ENTDDCPGNLCQNGGTCVDGINAYHCSCPSSFTGEFCENDVDECALRPSICQNGATCTNT
HGSYNCICVNGWNGPDCSNNIDDCVDAACFNGATCIDGVGSFYCRCTPGKTGLLCHLDDA
CTSNPCHADAICDTSPINGSFTCSCAVGYKGIDCSEDIDECDQGSPCEHNGICVNTPGSF
ACNCSQGFTGPRCETNVNECESHPCQNQGSCLDDPGTFRCVCMPGYTGTQCEIDIDECAT
NPCLNGGICRDMVNSFKCTCAIGFSGLRCQINIDDCMSQPCRNGGICHDSIAGYSCECQP
GYTGLSCETNINDCQSNPCHRGACIDGDNSFTCLCNPGYTGYLCQIQINECESNPCLFGG
HCEDLVGGYMCRCQPGTSGPNCEVNVNECHSNPCRNGAKCIDGINRYTCQCVPGYTGFHC
ETNINECASDPCANGGVCMDLVNGFRCECPRGYFDARCLSDVDECASNPCINGGRCEDGV
NQFICHCPPGYGGRRCEIDIDECGSNPCQHGGICRDGLNAYTCQCMPGYTGRNCEINIDD
CVNNPCRNGGSCIDLVNGYKCVCRGPFTGRDCESKMDPCQPNRCRNGAKCSPSPNYLDFA
CSCTLGYTGRLCDEDINECALSSPCRHGATCRNTNGSYHCICAKGYEGRDCTINTDDCAS
FPCQNGGTCLDGIGDYTCLCVDGFEGKHCEVDINECLSMPCQNGATCNQYVNSYTCTCPL
GFSGMNCQTNDEDCTESSCMNGGTCIDGINSYNCSCETGYTGSNCQYRINKCDSQPCRNG
ATCHDYENDYTCHCSYGYTGKQCLEYVDWCSQNPCENGATCTQQENTYHCACAAGWTGKL
CDVEMVSCKDAAARKGVDAKHLCHNGTCEDFGNSHRCRCARGYTGSYCHHEINECESQPC
RNGGTCKNLIGSYRCQCRAGFQGQNCELNIDECKPNPCRNGGICHDLVNGYKCSCPPGTI
GVLCEINTDDCTPGACHNNGSCVDKVGGFECRCPPGFVGARCEGDINECLSNPCSNPGTL
DCVQLVNDYHCNCKPGHMGRHCEVKVDFCANSPCLNGGQCSTRQSGHHCVCADGYYGKNC
EFSGHDCDSNPCINGLCQIADDGGYRCDCPLGTSGVNCELDILDECTSAPCEKGAPCQNK
LGDFECLCPPKWSGKTCGTYDPHYHGWYDTTQQQGGRGHKHGGAALPNIYAIDLEYQRSQ
CVKKGCREKQGNHRCDEECNTYACDFDGNDCSLGINPWLNCTASINCWEVFMDGFCNEEC
NNAACLFDGRDCEKKLQPCNPIYDAYCQKHYANGFCDYGCNNAECNWDGLDCENEKEPAQ
LAEGAISIILLMDAATFRLNAIQFLRDLGHQLRTTVRIKKNAAGMEMIYPWKGGTALQGL
TDSEFGRKHHVVYTETRQIGIQVYLELDNRKCIGMSGAECFGTANEAAEFLAATASKHSL
SKQFPIYQVKGVNPDDDGLPGATNVNYVLVGFFGLLLMVLVTVLVVNRKRAHGITWFPEG
FFTANTNVRRPSRRRPDGQEMRNLNKNPSMVDMVVANGGGHGSAGGAGGHGMMGHGQPWC
NSDDESEMPTARKRMRAIDQGYSSDHTAITDYEETEPRVWAQQHFEAADIRDHPAMMTPP
THHDGDVRDVDVRGPCGMTPLMVAAVRGGGLDSGEDIDSTDDSAAQIISELVAQGAELNA
TMDKTGETSLHLAARYARADAAKRLLDAGAEANSQDNTGRTPLHAAVAADAMGVFQILLR
NRATNLNARMHDGTTPLILAARLAIEGMVEDLIQADADINAADNSGKTALHWASAVNNVD
AVNILLTHGANRDAQDDKDETPLFLAAREGSFEACRALLDNFANRDITDHMDRLPRDVAS
ERLHHDIVRLLDEHVPRSPQMVTTIPAGSGAGTAGGGGGGNTIMSPTHAHMITHPTIIAS
AKQSKQKKQRQQKMNGGGGGVVAGSSAQAAAAAQAAAAAAAAAVANMGGGLSLGQNPTSP
QDGSCGAAELVAGSMRRKAVAKKPTGAAKKASGGGGSGGATPGHGGLTELGLADDQLSSV
ESPIANLNSPYDSVSLYSNAMTVHQLDAISPNGSGAVAGNGMMPKKPPSYEDCIKSAQSM
QSLHNIQLDNYGYSLGSNVTGGGGNQFSDLLMSQQRSLNNGGGGSGGGVGSLASNGMGPG
GNNLMHTAMHTMGESGLSPPYSNQSPPHSVQSNMALSPQGYIGSPSPAKTRPSLPTSPTH
IQAMRHAQQQKHNIQMISSSNLQQQQQQQQQQQQQQQGGTSLGCNGGGGPQQQQMGGGLS
SSNGGNTGNATSNSAMLAGLQMNFVNGSSGLELAGFCSPAGQGSQASTSQNTTGTTNSAM
TVASAHLSPLSQQQQQQVLAMVAQQQAQLNSQQQQQQQQAHHQMQQQQLQQQQQQQQQQQ
QQQQQQQQQQPQQQQQQQQSSFYQYLTPPSQHSGGVTPQHLVQTLDSYPTPSPESPGHWS
SSSPHSTSDWSEGVQSPANNVYVTSAAGHQANKGSEAIYI
Download sequence
Identical sequences Q7PSV8
XP_309208.5.40869 AGAP001015-PA|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]