SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP001381-PA|hypothetical from Anopheles gambiae VectorBase AgamP3.6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP001381-PA|hypothetical
Domain Number 1 Region: 942-990
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000977
Family Laminin-type module 0.0049
Further Details:      
 
Domain Number 2 Region: 458-523
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000134
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 3 Region: 1097-1144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000446
Family Laminin-type module 0.0014
Further Details:      
 
Domain Number 4 Region: 988-1040
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000837
Family Laminin-type module 0.0034
Further Details:      
 
Domain Number 5 Region: 1048-1099
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000142
Family Laminin-type module 0.035
Further Details:      
 
Domain Number 6 Region: 1149-1197
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000019
Family Laminin-type module 0.0047
Further Details:      
 
Domain Number 7 Region: 1200-1242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000226
Family Laminin-type module 0.0078
Further Details:      
 
Domain Number 8 Region: 632-670
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000103
Family Laminin-type module 0.0075
Further Details:      
 
Domain Number 9 Region: 395-447
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000145
Family Laminin-type module 0.035
Further Details:      
 
Domain Number 10 Region: 894-935
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000614
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 11 Region: 545-583
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000112
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 12 Region: 581-624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000162
Family Laminin-type module 0.0052
Further Details:      
 
Domain Number 13 Region: 1248-1295
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000307
Family Laminin-type module 0.0088
Further Details:      
 
Weak hits

Sequence:  AGAP001381-PA|hypothetical
Domain Number - Region: 1572-1680
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00238
Family Myosin rod fragments 0.013
Further Details:      
 
Domain Number - Region: 234-290
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0068
Family beta-mannanase CBM 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AGAP001381-PA|hypothetical
Sequence length 1893
Comment protein|protein_coding|2R:4053156-4061875:-1|gene:AGAP001381
Sequence
MHSADQHMVEIDVTVASDSISVPTHPTHPEPVLRGDQQPIDDGDSMEFTDEDEPTAGDSF
PNLQYTGMINNHINYNKYNSIFYPPGSFVPAGLDDAELDEKFSSRANRQHHRRRMHESEQ
YRSMQHHRFSGPWQQQQQQQRAGVASRPPIHRVHPCEQSSCYPATGNLLIGRENRLEASS
TCGTVRPERYCIVSHLEEKKCFLCDTRRETENDPMRNHRIGQIIYKMQPGTVEQTWWQSE
NGRENVTIQLDLEAEFHFTHLIIVFATFRPAAMLIERSYDFGKTWHVYKYFAHSCRESFP
HAPLVARNITDVICDHRYSGVEPSKNGEVIYRVLPPNMNIENPYAEHVQNMLKMTNLRVN
FTKLHSLGDNLLDDRDEIQEKYYYAISNMIVRGSCSCYGHASRCLPLEGVRNTVDMVHGR
CECTHNTKGLNCEECEDFFNDLPWKPALGKQTNACKKCNCNNHATSCHFDQAVYEHSGRV
SGGVCDNCQHNTQGYHCEECAPFFYRDPNEDIQSPYVCKPCDCDPRGSLDDGICDSIADE
ENGIVAGACHCKRNVNGRRCDHCREGFWNFDEHNPDGCQPCTCNTLGTVNNSGCNVYTGE
CICKRLVTGRDCNQCMPETYGLSDSLEGCTPCSCHPGGSLDNSCDVITGQCRCRPHMQGR
DCSEPKQHYFIPTLHRILEAEVPSTVSESEQNCSVVVRERANDRDADFTGPGFIRASEGT
VLKFTVDDIPKTMNYDVMVRYQPQMKGDWENVRMTVIRPEVYDPEGPCANSHPSYERDIT
TTLSEYETSAIALHDICLESGKTYKFIVSFQRHEPYDDNPTAQILIDSIVLIPRIEITPI
MQGSHQAEVRHREYVNLGCNHTYYDVNYILNAPEECKDLLKTISVYINNGAMPCECNPTG
SKSKKCAESGGFCTCKTNVVGRQCDRCAPGTYGFGPEGCKACDCNSIGSKDNDCDLITGQ
CNCHPNTYGRECDQCQPGFWNFPNCQICECNGHTPTCNSKTGECLHCQDFTQGWKCDRCV
DGYYGNPLLGSSIGCRPCRCPDTVASGHSYANECYLHPSTNDVICSCEEGYSGARCDVCA
DNYYGNPEKPGGQCQSCDCSNNVDPKRPGNCDSKSGKCLQCLYNTEGDHCEYCRDGFYGD
ALRQDCRACDCNLLGTNQTIQHCDRYTGQCPCLRNVKGQYCDECIENHWKIASGEGCEAC
DCDPVGALSEQCNPYDGQCSCKPGFGGRQCNQCEAYFWGDPNVECKPCECNAYGSATQQC
DRTTGKCACKSGIGGYKCDQCDRGYLGQAPYCEPCGECFDNWDMILDGLRNETDRTIEEA
KTIKKLGATGAYKKEFDSMSKKIAQIEGLLNNTISDREIEAIGGEIDRIRNHLQESLHNL
EESERKLQETDSNIKLANIEIVNLGRRADDVKQMTNYLKDNATKLQEGNIEGALNLTRDA
WYRVSMLGETNMNITAINSRAENYCRRAEHLINKNQADVVRNHENNEAAFLKYQEELNDL
NGNMPDLNQRICDRHGDPCDEFCGGAGCKNGCGGLRCENGALTLSEKALDFAKKTEQNIK
EKEELADDILRSMSQAKANASESYKKAKRTHDETQAHLEDTKDLIDRANILVVKLTDMIE
NTTASPGEMRELIEQVMSYTLQLDPEQIDDLAQKIQDAVSHLVNVESIIRNTENDLRRVE
MLKSDALDKKERAEKVLAGVLNITRALDDADDAQKKARQSIKQANADIASAKIDLEEIDK
ETEEAQKRANSTANAVLALQSRLEQLQKDNIRNELDAKDINKQAEDVKDSANNAHERATQ
LKNDFKTANESLTAQARRSESARERAQNLLNRASKITVDTTTQLSALQSMDDIYKSNEKE
IQNLEAELNDLTGKITFYLQTIQTNAERYRQCT
Download sequence
Identical sequences Q7PXF5
AGAP001381-PA|hypothetical XP_321757.5.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]