SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP002272-PB|hypothetical from Anopheles gambiae VectorBase AgamP3.6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP002272-PB|hypothetical
Domain Number 1 Region: 536-929
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.68e-128
Family Ankyrin repeat 0.00000000136
Further Details:      
 
Domain Number 2 Region: 195-551
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.65e-105
Family Ankyrin repeat 0.000000156
Further Details:      
 
Domain Number 3 Region: 1547-1632
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000538
Family DEATH domain, DD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AGAP002272-PB|hypothetical
Sequence length 2550
Comment protein|protein_coding|2R:18416769-18456860:1|gene:AGAP002272
Sequence
MAQFVTHIQPTLIEASQGHVPHHHGHQVGVPHTSHLPHSGHNMPSPPTHHGHSHGHVHGH
HHHGQGGSLVHSASRDMSHVKGSAGHKAPTHLPLSPKADDQHHHQPHYQHVEGYYQHAPM
HYYQQQQHHHGHSHGHHHSGSDGNTSFLRAARAGNLEKVLEHLKNNIDINTCNANGLNAL
HLASKDGHVAVVTELLARGATVDAATKKGNTALHIASLAGQEDVVKLLIKHNASVNVQSQ
NGFTPLYMAAQENHDSVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTR
GKVRLPALHIAAKKDDVKAATLLLENDHNPDVTSKSGFTPLHIASHYGNEAMANLLIQKG
ADVNYAAKHNISPLHVAAKWGKTNMVALLLEKGASIESKTRDGLTPLHCAARSGHEQVVD
MLLERGAPISSKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCG
HVRVAKLLLDRNADANARALNGFTPLHIACKKNRIKVVELLLKHGASISATTESGLTPLH
VASFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARARE
QQTPLHIASRLGNVDIVMLLLQHGAQVDAVTKDMYTALHIAAKEGQDEVAAVLLNNGAQI
DATTKKGFTPLHLTAKYGHMKVAELLLEKSAPVDAQGKNGVTPLHVASHYDHQNVAMLLL
EKGASPHATAKNGHTPLHIAARKNQIDIANTLLKYEAQANAESKAGFTPLHLSAQEGHTE
MSGLLLESKANPDHQARNGLTPMHLCAQEDRVSVAQVLVKHGANLQAATKAGYTPLHVAS
HFGQANMVRYLIEQQVDVNASTGIGYTPLHQASQQGHCHIVNILLESNADPNAITNNGQT
SLKIAQKLGYISVLDSLKSVTDAKATPDQPPSEEKYRVVAPEAMHETFMSDSEEEGGEDT
VLSDQPYRYLTVDEMKSLGDDSLPIDVTRDERMDSNKMVQSTDSHQFPPTALEDSISPQH
ASMVQSGISATDFTDNINIERHSHVGKLHWKNFLVSFLVDARGGAMRGCRHSGVRIIVPA
RSAAQPTRITCRYVKPQRTMHPPPLMEGEALASRVLELGPVGAKFLGPVIMEVPHFASLR
GKEREIVILRSDNGETWREHNIDMSDEIIHDVLNECFEPEELAQLDELGGGRICRFVTYD
FPQYFAVISRIRQEVHAIGPEGGMVSSTVVPQVQAVFPQGALTKKIKVGLQAQPIDPDLT
AKLLGRGVAVSPVVTVEPRRRKFHKAITLSMPAPRAHSQGMINQYSGSAPTLRLLCSITG
GTTRAQWEDVTGSTPLTFVNDCVSFTTTVSARFWLMDCRNIADATKMATELYKEAIHVPF
MAKFVVFAKRTDPLEARLRVFCMTDDREDKTLEHQEHFTEVAKSRDVEVLEDKPQYIELA
GNLVPVTKSGEQLALPFKAFRENRLPFAVRVKDQHADIVGRTLFMREPKIAKGEPPQQPI
CILNIVLPETIIPEQTTTITDSHEIMLRVGRVRAVVPPRQLVDDQNYLGELRIVDISNLL
GEDWIRLAPEIGVSETDVENIVAQIPASTAQQAQAMLKQFQSKPNNDFNILENGLRTIHR
DDIVERCIRSATTTGTTTTVTMRNKTSFSIGKRSVEAVELLSETDSIAKMAQKEDRLSKQ
ESTKYSAEEKTVEESEESEEEMVKKTVAERRKQIEKRLSADRSIPASTQKREIVEEIITI
KRQSVIDDTRAKHEEEILLQKPIDNTYKSSTMPEPVVKLKTTVVKDGPGVRKDEFEQELQ
DKFKVTLKNVEEFEHRSEVLEQLATEATSVSASSPRVVEEIKKKVEERVPAALDEPTEPA
EQQPVESAVPPVPKERAPVPAKRTSLTKEPEEFQGVVEESIKDVKQRISSFETKSKTESL
VDSKQSSVDTTSGRDSWSDDHRQASKRTDSEQISEDSEQEPLLRRDEHSSVQRTVGESSV
VTTTQQAFTTFEQLERHDVSHAVEEKRESLLEAFGAADAGPAQWKEPDSEPSSLSEATGS
STSRREESISQHFKSETVSKVEETVTKMSTTVETKTVAGLPGGLDAFTLGKGDETIVREE
FVARSAESSSIVDRTVESVVREVRDQEPAVEKRDMHREVQETADKMAALSSVETVQIGEG
TAPQVSTAAAYTVERFEGLQSEVVSQDAAGMVAERTGTAVSSVETGVSQGEDMVSEKIVE
REEEVRRRVEENVSIDKPVVQETVARTVTQEVTSKIPVPSKKSSPEAKDQPPMPAAQPTD
GEPSAVDRMEAADQPKQTIEQQQAELSSRAEEMIETVVEHAESVASRIPRFGTTKPAAPK
PEAVVAAKSPEPDTSSLSKIPVLKDRKVSEQFSSDSCETVIVQRSVEELQPHAEQVTASE
TVPDREYDEEIMSATAYGSERTVTEIITEDHRAVTPDDFIDEIIDEAQDKVQRQLQSAEV
TVGTLDLSHSEEESFDKSAYPMQEYISRPGGGSGFDANATIDDDDEDEEAEREREKWKGR
CDACMIPVSFHQPPSGSLTHSVRTVRSAFA
Download sequence
Identical sequences F5HIS1
XP_003436078.1.40869 AGAP002272-PB|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]