SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP002793-PA|hypothetical from Anopheles gambiae VectorBase AgamP3.6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP002793-PA|hypothetical
Domain Number 1 Region: 488-628,684-834
Classification Level Classification E-value
Superfamily L domain-like 4.93e-55
Family Ngr ectodomain-like 0.00000194
Further Details:      
 
Domain Number 2 Region: 51-251
Classification Level Classification E-value
Superfamily L domain-like 4.42e-44
Family Ngr ectodomain-like 0.0019
Further Details:      
 
Domain Number 3 Region: 264-469
Classification Level Classification E-value
Superfamily L domain-like 2.95e-41
Family Ngr ectodomain-like 0.00066
Further Details:      
 
Domain Number 4 Region: 1104-1293
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.15e-39
Family Laminin G-like module 0.0032
Further Details:      
 
Domain Number 5 Region: 1032-1077
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000109
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 6 Region: 951-992
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000767
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 7 Region: 916-959
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000192
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 1000-1037
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000155
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 9 Region: 874-915
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000213
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 10 Region: 1317-1356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000719
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AGAP002793-PA|hypothetical
Sequence length 1451
Comment protein|protein_coding|2R:27529148-27628492:1|gene:AGAP002793
Sequence
MMMTKRGIWSGPQFKMLMLLTVTVVLALMDMCLREAATREVTNREHTSSDDLQGNNISVI
YESDFQGLAKLRILQLTDNHIYTIEKDALHDLISLERLRLNSNRLKSIPDNFLSSAANLL
RLDLSHNALTAVPKRAFKGAPALRSLQLDNNQITCLDEGAVKGLTELEILTLNNNNITTL
PRDMFAGMPRLRALRLSENPFACDCHLSWLARYLKNASRLAPYTRCHSPGQLKGQNVADL
HEQDFKCSGLTENAPMECGGRSLCPHPCRCADGIVDCREKSLTTVPSTLPEDTTELRLEQ
NYITEIPPKAFANHRRLKRIDLSNNNISRVAYDAFSGLKSLTSLVLYGNKIKDLPASVFK
GLTSLQLLLLNANEISCVRRDAFKDLHNLSLLSLYDNNIQSLANGTFDSLRSIQTLHLAR
NPFICDCNLRWLGDYLHQNPIETSGAKCDAPKRMQRRRIEALKDEKFKCTDDYSKIKYSG
ECRMDQECPAACHCDRTTVDCSGRGLKEIPRDIPLYTTELLLNDNELNRIKSDGLFGRLP
NLAKLDLRRNQISGIEPNAFEGATRIQELFLSENKIAEVHNKMFLGLHQLKTLSLYDNII
TCVMPGSFDYLTSLTQLNLASNPFRCNCHLAWFSDWLRKKQLNGPPARCTSPSKVRDVPI
KDLPHFDFKCTSDMDQGCLGEGYCPPSCTCTGTVVRCSRNKLKEIPKSIPAETTELYLES
NEISMIHSNRISHLKALTRLDLSNNQIGILSNHTFANLSKLSTLIISYNNLQCVQKYALA
GLTNLKVLSLHGNKISMIPEGTFNDLQSITHIALGSNPLYCDCSLRWLSEWVKRDYVEPG
IARCAEPEPMKDKLILSTPAAQFVCSGKVSNEILSKCDACYTFPCKNEATCSALPERQYE
CKCKPGYHGTHCEFMIDACYGNPCRNNGTCTVLEEGRFSCHCLQGYTGSRCEVNIDDCVG
HKCQNNGTCVDGVNSYSCSCAASFTGEYCESKIEFCGKDFNPCQNGAKCVDHTTHYSCDC
LPGYRGLNCTDNIDDCVNHMCQNGGTCVDGINDYTCKCPHEFTGKFCEGAPMVAMMYPQT
SPCQQHECKFGVCFQPNPSSADYICKCAPGYSGKRCEYLTSLTFLHNNSFVELEPLRTKP
EANVTIVFSSTQQNGVLMYDGHNEHLAVELFNGRIRVSYDVGNDPVSTMYSFEMVADGKY
HLVELLAIKKNFTLRVDRGLARSIINEGSKDYLKLSSPMYLGGLPAEPGQQAYKQWHLRN
LTSFKGCMKEVWINHKQVDFLNAARQQKITPGCALLEPDSEGEMDDEFMQETPVILKEVN
PCENHQCKRGGKCVPNGKGGYTCKCKKGTKGKYCDQGEGSVSLVIDEDPFKTSSSAASTC
RKEQVREYYTENDCRSRQPLKYAKCVGGCGNQCCAAKVVRRRKVRMVCSNNTKYVKQLDI
VRKCHCTKKCY
Download sequence
Identical sequences Q7QCT2
XP_312121.5.40869 AGAP002793-PA|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]