SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP003389-PA|hypothetical from Anopheles gambiae VectorBase AgamP3.6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP003389-PA|hypothetical
Domain Number 1 Region: 176-477
Classification Level Classification E-value
Superfamily BEACH domain 2.35e-126
Family BEACH domain 0.00000000657
Further Details:      
 
Domain Number 2 Region: 532-671,702-875
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.04e-32
Family WD40-repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 78-175
Classification Level Classification E-value
Superfamily PH domain-like 2.21e-21
Family PreBEACH PH-like domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AGAP003389-PA|hypothetical
Sequence length 885
Comment protein|protein_coding|2R:37230093-37233259:-1|gene:AGAP003389
Sequence
MRLKLEPDLYHDPHTAAVNMRDNTTSSTSQSRRLSSEFGSTFAPAAIGEENTDDEMLLLE
EEMRNSLEAQVPETSGREKIVITQECELITLMTRVKGRFDLTTNQLMFTEIASLKDDGQR
HDFKFPIGQLRELHLRKFNLRRSALEMFLTDQTSYFLNFTTRTRNKIFTKILSLQPPNIL
YGSGRSPAELLKSSGLTQKWANREISNFEYLMHLNTIAGRSYNDLSQYPVFPWILADYTS
EVLDLNDPRSFRDLSKPIGVVNPKNEAEVRSKFDGFEDPSGMIPKFHYGTHYSNSAGVLH
YLIRVEPFTSLHIELQSGRFDVADRQFHSIPQTWKLLMDNPNDVKELIPEFFYFPEFLKN
MNRFDLGVLQMTKEKVDDVVLPPWAKTAEDFIAIHRRALESEYVSQHLHHWIDLIFGYKQ
KGPKAVDALNVFYYCSYEGAVDLDKIANPIEREAVEGMINNFGQTPSQLLRDPHPRRLSL
DELTIRLLKLELRRPDLTLILDRVQCTACDLSTDKDPVVYLSTPKSPPRSFLQTSPDMLI
TVTKSGILGCHSWMSFDKERGFLLEIDATTLNLKNRKKLTGPFHPSITLSSKLFALSVDA
KYIYAGGIWDNSVRVFNMARGKVVASAINHFDVVTCIAMDNCGSYLVTGSKDCTCVIWSL
STSNSVSQPAGSNLQPNTAALNQNLAGNVVGSANVVHLTNNLTPKPVHTLYGHDDAVSCV
AIMTELDMVVSGSLDGTVNVHTIKNGQFIRTINPIGCTGCKIEVSFITISYQGHIAFSAL
DDTSHSVHVFSINGVSLGSKYVSGRVTGLTSSSDYLVVSDDAGDVTMSRLYGLKPIFDIP
LHVPTQTVVGTVGNTHLLAPLRDGSLGVIGIQQPIPYKKHTVLNV
Download sequence
Identical sequences Q5TUA8
7165.AGAP003389-PA AGAP003389-PA|hypothetical XP_558841.1.40869 AGAP003389-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]