SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP003484-PB|hypothetical from Anopheles gambiae VectorBase AgamP3.6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP003484-PB|hypothetical
Domain Number 1 Region: 453-837
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.09e-123
Family Oxysterol-binding protein 0.000048
Further Details:      
 
Domain Number 2 Region: 59-182
Classification Level Classification E-value
Superfamily PH domain-like 2e-23
Family Pleckstrin-homology domain (PH domain) 0.00000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AGAP003484-PB|hypothetical
Sequence length 998
Comment protein|protein_coding|2R:38549191-38559123:-1|gene:AGAP003484
Sequence
MKFFLGITGWNDNSPKIESGFPDKNDSAKLNRKESYKAQRKNYRREKKRVASELLNSLQD
PAVIVLADWLKIRGTLKSWTKLWCVLKPGLLFIYKSPKTKSSHWVGTVLLTSCQVIERPS
KKDGFCFKLFHPLDQTIWAPRGPDKETMGAVVQPLPTSYLIFRAPSQAAGKCWMDALELS
LRCSALLVRSVPNIDTNLSEGATSTTHETQWSEADYEKHFDEHAPRLKEHLNYLLKYLPP
SPPEKKNLRVEPIEKSLPRSACPSPTPIFQQLYLAVAHWERYLRDSPDFFRCRSVDVGGP
LRRRMPSSSGTVSPAGADGDEEEDEEVFRCGGRDDGTMLMAGGRRRNSYQVGTAAETGDT
GKLMAVNGSEKLRRRSSPADFSQGHHGITIRISDDQYLDIDSQLDQGTMVSAGESDSESD
LGEGMDVEEFPETPYVHSPEEEFGAAGEQVEELPEEHKSLIWFLVKQVRPGMDLSKVVLP
TFILEPRSFLDKLADSYYHADILSKAVLEDDPFTRMKTVVQWYLSGFYKKPKGLKKPYNP
ILGETFRCYWQHENGSRTFYIAEQVSHHPPVSVFYVTNRQDGFCISCSILAKSKFYGNST
SAILEGVATLTLLPRGESYTLAVPYAHCKGILMGTLSMELGGKVSIECENTGYKTELEFK
LKPFLGGNEYTNLVVGKLKLGKETMATINGHWDSEIRIKDSRTNEETVLFNPTPDIRNRR
LKRFTVPMESQGMNESERLWQHVSAAIHRDDQVGATEEKTALEEAQRISAKERKATCTEW
VPLLFQQDFVTGQWHYKFADLRPWDPRNDLRQYESNYRIQTKTRHQAPMVRTASVVSTDP
LNILQVDSRGSLRKNRSGVMKSRKISSNTSTPDLNDPNSDSSHSNDHDTVLSSTRIMQTL
DDINKKLEEHSKKLVKLQLDMDKIHWAPPRRQQINADGPLAFLSSINVKTLVLIVVGLLV
QLLLSWFLIKRSLTTVTTSDTREGGDGDGGESAGNNSN
Download sequence
Identical sequences F5HJ75
XP_003436491.1.40869 AGAP003484-PB|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]