SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP003546-PC|hypothetical from Anopheles gambiae VectorBase AgamP3.6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP003546-PC|hypothetical
Domain Number 1 Region: 696-800
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-26
Family PDZ domain 0.0071
Further Details:      
 
Domain Number 2 Region: 337-430
Classification Level Classification E-value
Superfamily PDZ domain-like 5.26e-23
Family PDZ domain 0.00058
Further Details:      
 
Domain Number 3 Region: 976-1085
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.29e-17
Family Nucleotide and nucleoside kinases 0.0015
Further Details:      
 
Domain Number 4 Region: 801-865
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000643
Family SH3-domain 0.0039
Further Details:      
 
Domain Number 5 Region: 487-569
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000145
Family PDZ domain 0.034
Further Details:      
 
Domain Number 6 Region: 2-81
Classification Level Classification E-value
Superfamily DEATH domain 0.00000753
Family Caspase recruitment domain, CARD 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AGAP003546-PC|hypothetical
Sequence length 2577
Comment protein|protein_coding|2R:39365615-39417190:1|gene:AGAP003546
Sequence
MRHRLSIVRDLIGTSLVQVLLKAGVLTVAQEEQLTGEPSLDARCDQLIELIARDGFEKFK
QFCYAIESECSQLISDLINDKLSQAEEELQEEQVGVGVQHEWKTIKDTIDSNRSRRSTSY
CGTSTPTPTTVPIGNTVSSRRSSLISATVSAASSQQQHQQQPPPIPQLPSKALVGSAVAH
IELGESKFAVSNNNFNNSALSSSSSNSNNQSNNNHQPSNGGSVAGSATVNGGVPDASVLS
SIRQALGQGHHLPPSNKRLQKSESAAYSYFNPKRFSSPPFGEILGGTTDRRLNLKNKTAS
LFRSKSKKEQRTYRSVNDAIEVLADQVVEDEKALERTSWDYSTVTLSRVTGYGFGIAVSG
GRDNPHFANGDPSIAVSDVLKNGPAEGQLQVNDRIISVNGVSLENVEYATAVQVLRDSGN
TVTLVVKRRVPNHSLMHPLPGGPSAGAMGVGMPAGVVGMNSHQHQHSISSTGLGLGANNG
SQQQIKVIVTKANKKDDFGIVLGCRLFIREISSKTKDQLAANGYSLQEGDLVTRIHNTNC
NDSMSLKEAKKIIDGCKERLTLAVLREPNGIAGGYGGGAAGGGGTASGMQSPVYSHTAQV
SNCSNMDENYLNGTGGGSYSGQNLYVQPPTRPSAMSTLLADDKSNLTPRGRSRGPLTDIS
LQQLDRPSTPPGTVVDEPPRPPPPRGEDFYATRRQLMDEKPPTTEPRYITFQKEGSVGIR
LTGGNEVGIFVTAVQQNSPASAQGLVPGDKILKVNDMDMNGVTREEAVLFLLSLQDRIEL
IVQYCKEEFDSITAQQRGDSFHIKTHFHCDAPTKGELSFKAGDVFRVIDTLYNGVVGAWQ
VLRIGRGHQELQRGVIPNKARAEELATVQFNASKKELNASESRVSFFRRRRSTHRRSKSL
SRENWDDVVFSDAISKFPAYERVVLRHPGFVRPVVIFGPVADIARERLMKDFADKYTAPL
QDDDKGSSKCGGIVRLSNIRDIMDRGKHALLDVTPNAVDRLNYAQFYPIVIFLKADTKHT
IKQMRQGLPKSAHKSSKKLFEQCQKLERVWSHVFSTTINLNDPDTWYRKLRDSIDQQQSG
AVWMSETKPVESLSDDFLFPMTTSRLSYASSPESDLELSPGPSASLSLGNLPQLVKSSSD
PSIATNQDNLDRDRELGDGMPPPYTNPYEHGPHSRRMTVDNKYGFSSSKNGIGGGPSMNP
EDAIYGSSTSRPAPPLQGTANGPHFGTVPDLPPRIDRASKPANAPGAPSTSGSSLPSRNS
SSGGTLGRSAQERLFGNGKQSSTDALHDPTSSAQDEYSSRNQLLGLGAGDKRPTLPPMVN
GGTTAPGAASSLERNPNANTSLDRSGGGGGGGRSAGHHHPGNNPQNTSGKANGSYDSVSS
YDSYNTSSQLTAQNMRLGPNAPDDLKSVPNRNGAHAMGANVSGLSDYGRNPALNNAPSDM
LLTTARSNYNVHETLTQRNSGDRTAGGMNMPQRPTNLVLDSPRKHIIETKTDYGKYSRNN
SASQADYSKPNKGPSMIGSPGPPPGAMGANMGNGAPFKPVPPPKPKNYRPPVGGSGSNGT
GMHHSGQWDNGEPISPRSPDGFYYPPMASSHYHQGMAHNVPSSPNNGGSHAPGMHPYNPY
TVGNGANGGNGGPMYNGNANGSHSYMSNGVRDMGAMGASNGYNNGNAQYPYGNTYMHRGN
GAGTHGIALHPSDRHALDLAGSREQRGSAFELYRKPQLGTMVGHHHNIRDMEPMMSIHEF
NQHQQHLMHQERMRQLQQQPLPPIPRPPPPTSRGPYPGHDPSLPPELPAKPPKKNILKSP
LKAIKNAFIKSTRPLRRQVSLAGDSDKKSLRPILKRQHSMMEPRSARMRMPDQQHQQLYD
QQRSMYAQEMQQQAYYNDPRYGSSYQGPYSPQPNRSYQRHEPYYPKDGNSTYQNLEMESM
YGNSQGRGGYYDQQSEGPGYYPTDENLYANRALIELERSRAPLGPGATVSTLGRRIVRRH
SMADRTAPSPSFNQLNRRRMGSERAPHHASIVDHHRAVMANANVSRGSSAHDESIYQSKS
GSFLYNEAREHNRRAFEDPVYQSRREMHRDHLYQSKQQMQDRIQQSRMVEMVAPAQTQPQ
PAHGSSPASGNGSSSMGGTTTSAASDRFLRSQGLSGGGGGGTASGSNSSSPNSPSSSSCK
SGYSSSRNGGEMRERRTQMRDQIYQSRKEAMESMAEPVYVSRRELKHEPIYESKNENESA
SVASAGGAVDAPVNEMQGLRLNMPEPFAGENSGQKAKTEQPEASSKHTTPSTPSTGRKPQ
DLSAPLAAEEDDDVEDEEEQHEQSDERTLTVSNQNDSVFEKLAMGVVPSPGSPVATSSPV
PSTLGTPKSIRATHISNFLKRTAPPVMPPPPPPPTALNRPSLPPSEEAGPATAAVYASRT
SIETQYTSTATGSQMSLPIGPPNATSTPFASELSLGLPPPRQPITRRGLFDASGGSLADP
IWNVSLQIPPGAIPPGVQQEIYFTVTDPRLSESVGGPPLDMENGETMLSPLVMCGPQGTE
FLKPVTLNIPHCAGRTASLGLSLKATDSEKNLQTDWEDIDLPSNTAAHTVSVKVDHF
Download sequence
Identical sequences F5HLA1
AGAP003546-PC|hypothetical XP_003436520.1.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]