SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP003873-PA|hypothetical from Anopheles gambiae VectorBase AgamP3.6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP003873-PA|hypothetical
Domain Number 1 Region: 1002-1203
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.77e-24
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 2 Region: 1216-1415
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.77e-18
Family Laminin G-like module 0.023
Further Details:      
 
Domain Number 3 Region: 362-404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000142
Family EGF-type module 0.005
Further Details:      
 
Domain Number 4 Region: 709-841
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000298
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 5 Region: 400-438
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000026
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 6 Region: 1803-1840
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000322
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 7 Region: 681-723
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000822
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 8 Region: 1921-1965
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000159
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 9 Region: 203-241
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000508
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 10 Region: 900-945
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000753
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 11 Region: 1459-1482,1540-1702
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000206
Family Laminin G-like module 0.065
Further Details:      
 
Domain Number 12 Region: 287-322
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000231
Family EGF-type module 0.026
Further Details:      
 
Domain Number 13 Region: 1765-1807
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 14 Region: 243-280
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000042
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 15 Region: 610-651
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000503
Family EGF-type module 0.009
Further Details:      
 
Domain Number 16 Region: 646-682
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000529
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 17 Region: 28-162
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000256
Family Laminin G-like module 0.051
Further Details:      
 
Domain Number 18 Region: 1884-1925
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000635
Family EGF-type module 0.011
Further Details:      
 
Domain Number 19 Region: 320-363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000839
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 20 Region: 1844-1886
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000155
Family EGF-type module 0.011
Further Details:      
 
Domain Number 21 Region: 1960-1998
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000522
Family EGF-type module 0.013
Further Details:      
 
Domain Number 22 Region: 1731-1770
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000536
Family EGF-type module 0.015
Further Details:      
 
Domain Number 23 Region: 499-549
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000771
Family EGF-type module 0.016
Further Details:      
 
Domain Number 24 Region: 2001-2042
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family EGF-type module 0.0083
Further Details:      
 
Weak hits

Sequence:  AGAP003873-PA|hypothetical
Domain Number - Region: 941-979
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000268
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 549-580
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000451
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 1460-1518
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0022
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number - Region: 884-906
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0109
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 837-857
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0135
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AGAP003873-PA|hypothetical
Sequence length 2118
Comment protein|protein_coding|2R:44864356-44878176:-1|gene:AGAP003873
Sequence
MFWHLLGFGIRIMILQCSVQTVTAIQTEKEAYFNGSAYLRLKTPMTLWSYSAISFKSCRG
GEILSQRYSGHALLVSVLPDWVSIVLSTPAQQPIEARVTGRLLDNRWHTLELIYQAGTLY
CVIDKQSTPIANQSYNAQLIHDQEIKNEAAVLILGKQYSGCLLHGPGLVFNSSAMNAEAV
VFGPCPLAAGPCSDHDVLEGVPVDYCSHDPCMQHGTCISRSDSYECHCTARFKGKNCEID
MGPPCLSYPCQHGGTCLEDSKGEYRCTCAPGYTGAVCDTELSVHPLCEKNPCANNGTCRV
APGTNTVECECLKGFIGMRCEVNWDDCKPNVCLNGGRCIDGVDAFTCDCKGTGYGGTLCQ
NNIDECLANPCQNGGTCFDTYGSFLCDCPSGFTGPKCQMSVNECKSQPCQNGGTCIDTRE
GFECRCIPGYNGALCELEPGCGQCPPDSECIAGRCVCKPGTTGMVGLCVEQVTAAATATI
ATNVNAAGTSAQKSQALTNACASYCYNGASCVPAPGPAGFAQNFTCLCASGYTGTRCESP
IALPYSDECNCLNGGSCTPNGSACLCPPGYDGARCEQPVGNGLCSPANCAEPYRCIGGKC
QCPDNMNCDNPCASSPCLHNGSCYLQGQGYACKCTSGFEGKRCENDIDECKKDGICGNGI
CQNTPGSFRCFCTPGYTGLNCDLDVDECLSHPCKNNAECQNKQNDYECICPAGYTGKDCS
VDIDECESNPCSKGSSCVDQVANFTCMCVPGMTGRLCEIDIDDCESQPCQNGGRCIDQLG
GFQCDCNATGYSGIYCQTNINECESNPCTNGAECVDKINDYQCNCFPGYTGKNCEEDIDE
CESVPCLYGGTCLQRSNYSLYQPPALAGAKGLPVHFAQPFSYAIAAGYECICVPGTMGTN
CETNINECESNPCKNGACVDGVGNYTCECDPGFEGSHCETDIDECLKYRPCVHGTCMDGR
NNYICDCDGLWGGKNCSVQLTGCVNEPCLNGGTCVPYLENETQHKFNCSCHQGFQGKTCD
TVTTMSLVASSLLVVNTTRDEGYDIQLRFKTTLPNGILAFGNGATSYILVLNNGRLNLHS
ALLNRWDGVFIGSELNNSKWQKVFVAINSSHLVLSANDEQTIYPINSYEGTNGSNTSFPI
TYLGGTIPSLAQPYLKHIARAVSSFVGCMEDVVINGQWVLPGQEQEFTTLHNIDTGCPRT
PQCEPNPCHSNGHCTDLWHTFSCSCQRPHLGHTCKYNITAATFGHENTTNSAVKVTVSDV
ARRAIRSVLDISMFIRTRKPSGQVFYLGSDPDNQNANANQSPSDDSYVAAFLSKGELLVR
MIFNDTPEGYTVGGNKLDNGYLHLIEVIRNSTLIQVKLNGTEYFRKTLSTSGQLNAQVLY
LGGPPPNADTINSLYKDDSEKQYFKGIIQDVQVSNGSHAMIVELYPLGNETEGLELPAPF
GQVTIDRTSVLEGIVSDDLCRSQPCYHDAYCENTWNDFICTCPRGYKGKYCQDIQFCELQ
KCPMNATCQNLDAGYECISNMTFHDDKEPLVFSFNDKDRKDISMDTIEISYRTKFGGTLL
YVHDGDMYFEISTIRQLVTISWLLSGDLPETHRFERELAGEDDSYDWHTLLVKVSQGGKL
EAGWKGWETAIDPQPSLTADIDYFAFRHLFSGRQQIYLGGMPEMAHIENNSVVSGGIDKG
SSFKGCLGETRVGGFLLPYFPHELIYPDTFNLTEGHFTLNSSQPEQGCILCFQQSCKNGG
VCSNPSEQYACECPAGYESDDCSQNIDECLAANCANGATCVDGVASFACQCVEGYEGQLC
EIEINECDSNPCHNGGVCQDLLAGFTCTCTEEYAGPQCDVFRLVTCENLPCRNGSRCLDG
YNMTTGNNFTCTCSAGYAGPLCDVPFCRLEPCQNGGMCDTEAMIPVCNCLPGYVGMFCET
ELNECESAPCLNGGQCIDFINEYRCNCTGTGFDGKNCEHDINECLQERISCGGRGHCINT
EGSFRCHCEEGMCGKDCAQSDPCQVNPNVCLNGGICVEDCDRERRYYCNCTGGYTGVNCS
EQATLEAEEASGADIALIVVPVVIGILTIAGALIGTFLVMARNKRATRGTYSPSAQEYCN
PRLEMDNVLKPPPEERLI
Download sequence
Identical sequences Q7QFS2
XP_310433.5.40869 AGAP003873-PA|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]