SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP004144-PA|hypothetical from Anopheles gambiae VectorBase AgamP3.6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP004144-PA|hypothetical
Domain Number 1 Region: 2923-3221
Classification Level Classification E-value
Superfamily BEACH domain 2.09e-103
Family BEACH domain 0.000000206
Further Details:      
 
Domain Number 2 Region: 3355-3387,3455-3525,3575-3669
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000631
Family WD40-repeat 0.018
Further Details:      
 
Domain Number 3 Region: 2829-2906
Classification Level Classification E-value
Superfamily PH domain-like 0.00000369
Family PreBEACH PH-like domain 0.021
Further Details:      
 
Weak hits

Sequence:  AGAP004144-PA|hypothetical
Domain Number - Region: 1127-1135,1233-1274,1313-1351,1761-1964,2220-2328,2371-2508,2594-2640
Classification Level Classification E-value
Superfamily ARM repeat 0.000283
Family Armadillo repeat 0.063
Further Details:      
 
Domain Number - Region: 1411-1471
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0452
Family Trypanosoma sialidase, C-terminal domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AGAP004144-PA|hypothetical
Sequence length 3686
Comment protein|protein_coding|2R:50718580-50730810:-1|gene:AGAP004144
Sequence
MALESPVRHTIGQLCELWAHIYDCHSSADIYQRKPEIEQFLEGFNQLSEEDRLHLDRLNR
YENISSALSRQLLLLIYEICDPAVKRYARADSTSTTVGSRNNSSTATITTPPAAFDEASH
AEERTLDGNADEEEAKSLLRADSSESRCQWLKDFFLNDIGGLLLRTLSKIGAKDIANSRE
IAALLVRILPTTKWHPADSCPTNSPLALQPGYGEFLRNALKMPTYNGDWYRDNFKRSLQN
GGTTAALLRSYSNSQEGGGSGAIPAAFVRQLSGPKTFATTADYASATEHLHRCTVSDSKT
LSQDQFTLTVLDLLESLVVHENVLTIDENSVTVSCLRVALEQLKRQERLEESQENRHIIR
HKLLGLVMLCLNNMFFLESLDSNDLSLRAVASDMIELLREELNERPTDALSSEFTYNLIY
TIVAAVNQTFLHFCHNLVSEQLFLTIFKLLESNVEIVKHTYSYLQLGTRACGSKHNNNNR
YDVEPCVQMMPNCSSGLIEILIKMLQNFIFALAPTRASYRKARKSRFRLHHSRLEARNGY
VCALENLLLNLFPQVKHSDQRLMVNFFKVYQLCCCNTNANTLEVLMKLSNDELIPKLRLT
FASRAVVHSIFNRSQCETCESDRAANTFYEQFTRTHREVFGEFRRMENRSRMPTFLRYLL
DIARVIPYRLRSFMLQELVLKLLQDELDRMKEGRESERTVTRFASEDDGGRDIVNACLLI
VCRVVMQQEEREMSLFYREETLELLRVLSGRVEFAHSMHLIMTIGMRGGSLAEEFEQKLA
EILFSNLDEQIAYVGSLFTTISDSKLDVPLKSIEKQSPSRRLQREESLETILQLHQEHWK
TVRQLLKESKRFRKLFLRRYDGANGVRQFLDLTYNLASVCLFRSRLKSIQETVPTLTEQS
SALFQLTNHGEQLHGFEPERRSVLNIFHFNDQLIDGSLSSAGSLYYSATANVAHVGTIPT
PGTLEEEDDFSFLRELQLATITEEWQREFLFPNGQSAVRDSKLEKKWSLTELFNIRQMLS
NLMEEILGGPEHQDSLERRINSLPADARKLLIETGNPTIRKRLTSLLEIVMASMQLLMDG
LPGSTEDCESLKPELANAMQVALLELKKMLLNCATKDWDCPSTANNVINVLHALLKVAEM
RKDSAAMPYVIQRDVVDTERERSAFAKMQLYDHEVDQLVAPLYHEEERDDLSSTDESFTT
AREDGYEGDVEIDPYSPAELIARKQSIGGVKQCNANRLVNEQICSIVTEILVELSRRCVE
RPDHWCPVLAQMVVKLNIIRNYLGGSLYLIRGFATVLQTSDARLKELQAAIVDLIVDLDV
PEVLIKFVQLLGHKDPPVQLILTKLANLFEAGSGLECYQCVQFPVLHADRTFSSSCDVLL
AKKITFLREHHLFFNVRTGLTDAATIVPLNYANFYPWHGSGFTVSAWVRVAQLADRQQTD
FTHLFSVGSEKQMLSVYFNSQRQLVVRFSKPDRLIAPTNTKQYLSKAISRSECCDNCTKE
MQHLWMYKHLLRGMTEAASHTFMLDTPRAQCVYCFKQLPVGQAWKEAAEYSVDSSAPKRV
DPDPADVLLRQCTIGQDWCVPEGCWSMLTFAVQQNDDSVQVTVTHDGVQQLAQFSLPNPC
KIHIDTDLTVLSVGHRSGGPNECSVGYGMSGVHVFSRCITDEAALANLYAIGPNVTNFVA
FASGYMIPNYGTLNLSKLSTDTLRTVASLQLLEKAHLGYLTANKLESFVARHQNIGLMSY
AGRLRSIEIESLQRSLLTAGGVSIMLVCFARVVELSESPALHVAALKLLLRVTHCNHDFF
NEFVQCNYLELIGVVLKNKKCHKDVALLTTLLEVAFDQPIVAKRGDHYRVLTTSSARIRY
PGMVTFLLENFQIWIDQSEEVLDILLSVLATATRDKHPGMMYNCQRLQDASLVSALIDFC
RVNFVIPAKTVKISRNAADLLVSLIAILSQTPPKVTLLNEIMELLLLMHKPTDSYVTHDR
QKFYFNISPNQFGGGGKQRGDRTAAASSSGAVSSSGPSTPKLQLRDRRLRPQTQLRKILP
LTIASGSNSSFESATTSFIIDTSQTAATNANSSPNTTVSPDDKSRSATANTPKSPKMSSP
DGGGLGMEEYYEKLNKAIAEGKLRRKSLLDSLDRGSSKRKLRRLKSTPNIRASSGSRKKQ
IGSPRLTGGSPRRASCCARNEASRSNAGPQQHQSQSAPTTSSSSTASTTIRYKFFEQNYF
ATGNDFLQESFLRVMCDFLLILPDSDACKFLSGENRILETLLILANNGNIRIRTMLLNLV
AVIDDRIDGARTAGSSGVAGGSTGPSGGGSVLQQYSEEQSKVFWYHLANQIGTHSVNAEL
LGSCYRWITKSHAPLAMDRGDDHPLATLLQDRSVEIVRENGLNVLIAILIQAHIDPTLFR
GVLHVIEYVCTKHRRRAGQHMIDNGLVWALVKTAVKMNEKEELVQEESRAYLLEFLTSFS
HLMILSSVANPFWDLLNGLTVAQKHKNERVTRAVRDLHAALLRNVLQIFIFRPKQSIIAF
TVELAGCVLSKSEVKTRFNRLHDKAIQFVTNSDPDGELSDPETALIRHLMNRTLNGNPRG
GNIILWCLLPKRSIRLKIYTIKQLGQYLESGGNHLSAICDVKMLKVFVQSILLLNQKHIP
LEDLRLVNAFYQSIDGGLSHGASWNLTQTLKDFEYLRAISMNDQEQTIMKSIARQEKLIY
SCTVAAMQITRNSVEKQNRLRKELIIQLRKDNDYRFYDQWHRLVDRMTHDDAPWYNARLY
PNSWELDDTYGPDMALKRMRRCPMTIDRRFLLKETVPESKHGAEEEREQTPLLAYLFSND
YRHEYSVEEQVLYTFTVRKTSPSYEQECECIITSTELVLKPYDAGELEIYDLHDITKIWT
KRYEHQESAVEVFLKCGKSLFIVFHRDPSERDTFEGFFHDLVVRCGRQELDHYTQQWREG
ALSNWEYLMLLNQIAGRTYHDLMQYPVFPWVLANYDTRTLDLLAERSFRVLEKPIAVQHR
ELEKHYINNYNHLRQAESGDPNGGRRKIQPYHYSSHYSNSGTVLHFLVRVLPFTSLFLQY
QDDSFDIPDRTFHSLQTTWNLASKDSPTDVKELIPEFFTFPEFLENQEGFDFGTRQSGEP
VNHVELPAWCGGSARLFVLIHRQALEANIVRRQLSHWIDLIFGYKQSGQAAIDAINVFHP
ATYCDFTASDIDDPVMKLALETMVKTYGQMPRRLFDTPHPPPAMNPLVANPPKVLESVIG
LRWGLYCGSPILSDPRLADVWEKHSKESLGGIVIERGTLPPAALATLDGDKVFVLPDKMN
IFCATTQGTGSKKHYTISWGEMDDRLRIRLLQDTGSTERPRELFYGSNSVAYDPITACGS
DAHCTSIFFGHRSGRIVVFQQRSRRRRGSFFNQNMQPSVAMMSRSRSSSFRRWIDRKSAN
LRRRLEMDPDEQQPQPQQEQRLPPDDQIDWAYPIQLLKHRAPISAIRISMEYKIAVSVSL
DGCAAIWDVNSLMYVREIPKPVNMLHSRISHVAISPTLGDIVLVHSASAGSARPATATTG
GQESWSSATLVEEDDSFEVTENYNADYVNITMDTNRRDQLRLYTINAQYVEHVFVESPIQ
AITYSTVKEGCGVNCIVVALESGIVRFYSSWNLALLREVNVEPNGVKCALFSKYQHLILL
TDSNIVQTWTAEGLAGALPSIQEPYQ
Download sequence
Identical sequences Q7QB76
AGAP004144-PA|hypothetical XP_313026.4.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]