SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP004766-PA|hypothetical from Anopheles gambiae VectorBase AgamP3.6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP004766-PA|hypothetical
Domain Number 1 Region: 11-227
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.03e-59
Family BAR domain 0.00000164
Further Details:      
 
Domain Number 2 Region: 255-338
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-23
Family SH3-domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AGAP004766-PA|hypothetical
Sequence length 344
Comment protein|protein_coding|2L:3168038-3175379:1|gene:AGAP004766
Sequence
MAFAGLKKQINKANQYVTEKMGGAEGTKLDLDFMEMERKTDVTVELVEELQAKTKEYLQP
NPTARAKMAAVKEGILADCMLTYGKKLGEDSIFASALVEMGDSLKQMADVKYSLDDNIKQ
NFLEPLHQLQTKDLKEVMHHRKKLQGRRLDFDCKKRRQAKGSQITDDEIRSAEEKFAESL
QLAQVGMYNLLENDVEQVSQLVTFAEGMLDYHSQCSEILKVLVETLNEKREEAAARPKSE
FVPKTLADLNIEMLGSQDGMNASPLPSPMRSPARTPMPTKPTQPCCTALYDFEPENPGEL
GFKENDVITLIQRVDENWFEGSLNGRNGYFPQSYVQVTVPLPSN
Download sequence
Identical sequences Q7PJI7
7165.AGAP004766-PA AGAP004766-PA|hypothetical AGAP004766-PA XP_318050.4.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]