SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP005252-PA|TOLL from Anopheles gambiae VectorBase AgamP3.6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP005252-PA|TOLL
Domain Number 1 Region: 160-304
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 5.36e-27
Family Toll/Interleukin receptor TIR domain 0.0022
Further Details:      
 
Domain Number 2 Region: 25-120
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000135
Family DEATH domain, DD 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AGAP005252-PA|TOLL
Sequence length 462
Comment pathway signalling.|protein_coding|2L:13194968-13196429:-1|gene:AGAP005252
Sequence
MLDNPVKPTEVSVKNRIDLAVVPLEALSSRTRELVAELLNHKRIFTSEDGYFRDWRGVFD
VIGIPKSFLPLVSTNPNPTRCLLDLWQSETHQCKREPNLAELQCVLGCIDRWDILDDTSK
MFERDAEQFLLREQKRAAQRGRETEATESKVSADSDIITRDDTSDHKQQYDAFILFADAD
IEFASKMVDKLEARGLQLCLRDRDILGGSNFEHEVISRLISERCRRVVVIISKAFLASPL
NDFTVTFAQALQIEQKARKVIPCVYDRCELPPHLRYTCRLDYQRSQNLYNFWDKLAESIR
DTPRKVGLEVSGRELPAPQKPPVHSKPVELIGPPQPLPKVVVEQPPLVVKLPRAAEQDSR
TGSLKKSHSFWDIFSNFGHKKDKLNGSTSQLNLNEMATPLPSPKKVGSSPLALIRRDKKQ
PSAASASSAPSACPLDLPPVIKPVKSKKKWYKPGSRKLASAV
Download sequence
Identical sequences Q7Q9F4
7165.AGAP005252-PA XP_314167.4.40869 AGAP005252-PA AGAP005252-PA|TOLL

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]