SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP005465-PA|putative from Anopheles gambiae VectorBase AgamP3.6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP005465-PA|putative
Domain Number 1 Region: 110-210
Classification Level Classification E-value
Superfamily Hormone receptor domain 3.4e-24
Family Hormone receptor domain 0.0008
Further Details:      
 
Domain Number 2 Region: 174-468
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000000604
Family Rhodopsin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AGAP005465-PA|putative
Sequence length 576
Comment diuretic insect hormone receptor 2|protein_coding|2L:15913994-15948647:1|gene:AGAP005465
Sequence
MQSCLLSATLQPKPQVKPRTAVRYQTNRDQTIYVPQKFCPTRLWTVQMTGGIISNSIKPS
GQRTTPTTLIRLQMDKIQPHASGKRLVSVADYDELSSFPPELLGAFENSTEFECLLRAHQ
DAQSETPSGGCPVDFDRILCWPKTDPGTWAVLPCFEEFKGVHYDVTQNATRYCHPNGRWD
NYSHYAACHHVNEPPPDIVEISSIIYYTGYILSLVALSLAVIVFVYFKDLRCLRNTIHAN
LFITYILSALLWIIILTLQLSSGSSTGMTSCVIFVTLLHYFTLTNFFWMLVEGLYLYMLV
VETFSGDNLRFNMYAAIGWGKCSRASLEIECSWMRESVVDWIFQGPVCAVLIINLVFLIR
IMWVLITKLRSANTVETRQYRKASKALLVLIPLLGITYLVVLAAPAEGVVSDIFAIARAL
LLSTQGLSVSLFYCFLNSEVRLALRHRLERWRDERNIRLGQVRQRSRRMEKGPSKPESEP
ESIHHATESLKGFILPFSSAGTVPLTYNKRESCASSATTTTLLGPHSYPSAMRGSNGALH
MQSIVPRAISPLMQVRRWGEGRKSVTNYYPLRGAGN
Download sequence
Identical sequences Q7PP23
AGAP005465-PA|putative AGAP005465-PA 7165.AGAP005465-PA XP_315468.4.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]