SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP007850-PA|hypothetical from Anopheles gambiae VectorBase AgamP3.6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP007850-PA|hypothetical
Domain Number 1 Region: 702-753
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000331
Family Laminin-type module 0.0066
Further Details:      
 
Domain Number 2 Region: 857-898
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.0092
Further Details:      
 
Domain Number 3 Region: 904-946
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000698
Family Laminin-type module 0.0066
Further Details:      
 
Domain Number 4 Region: 760-815
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000921
Family Laminin-type module 0.0067
Further Details:      
 
Domain Number 5 Region: 311-355
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000234
Family Laminin-type module 0.033
Further Details:      
 
Domain Number 6 Region: 247-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000795
Family Laminin-type module 0.077
Further Details:      
 
Domain Number 7 Region: 818-859
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000893
Family Laminin-type module 0.0054
Further Details:      
 
Weak hits

Sequence:  AGAP007850-PA|hypothetical
Domain Number - Region: 412-448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000193
Family Laminin-type module 0.021
Further Details:      
 
Domain Number - Region: 353-392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00151
Family Laminin-type module 0.019
Further Details:      
 
Domain Number - Region: 59-138
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00198
Family Galactose-binding domain 0.07
Further Details:      
 
Domain Number - Region: 658-700
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00446
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AGAP007850-PA|hypothetical
Sequence length 949
Comment protein|protein_coding|3R:2078296-2093674:-1|gene:AGAP007850
Sequence
ASGLWPSFFNVALRATISVNATCGQTGREEYCRLAEGAGRSRGSQCGICDANNPDPEKRH
PITNIVDGTNSWWQSPTLQKGAKNDRVTINLDLGQLYQIVFFTMRAAISPLPAAWVLEKS
MDGRAYDAWQYFAADDTECRERFGLPAYTANYIFKSDTEVICSTQFSSLEPLENGEINLS
IISGRPSEMITSPELQNFTLARYVRIRLLRMQSAEAQRFKTKCFMCTKSFSSRSFYTIRS
LRIGGRCFCSGHAGKCKTMDNNIDNEPQCECVHNTCGANCDRCCPLYNQRPYRIGTPVAA
NKCEKCEVGNRLLGGVCQNCTHHTTGVNCERCLPGYYRPMDRLPNHPEPCLPCNCTSPGA
VGECSPIGGECRCLEGFTGAQCTECLPGHSGDRCTRCDCDARGTLSGRECDERCSCKAHV
VGERCDRCDEGYFALNEDHIDGCLKCYCSGVGTKCSVAHVETSSYTTLKGWTVTNLAMSE
HIVPTKDNDTGFLVFGMFEMPETEAVYWKAPEGYLGNLLRSYGSQLTFKMDWITVRGDTS
GKPTVGPSLILVGRNGMKIAYGEESYEETGGATITVPLKEDSWYHVPRTVKDIITRLRRT
EYHGDPVTRSQFMAVLTDVEVVLLRGTYHTDQVESVLEQADLFSGSHSTTDSSASSSGFI
ELCECPEGYRGTSCEQCAFGYVRIYETSVTHERIGRCIPCSMCNGHAASCDLETGECGLC
LHNTVGTNCERCLPGFYGNATLGRPDDCKRCACPLESPSNNFSPNCQSRGGSSDPSEYVC
TQCPEGYTGDHCELCDDGYYGEPTVIGGQCLPCPCHGGPCNAQTGECIECVGNTEGWRCE
RCKTGYWGVPDDGCEPCSCSELGALENVCDVTTGQCICKPRYGGRRCDECDVGYGNLDLD
CPACECNVNGSASTVCNVVSGQCECNVGTEGIHCDRCREEFFGLSDEQP
Download sequence
Identical sequences Q7PN80
AGAP007850-PA 7165.AGAP007850-PA AGAP007850-PA|hypothetical XP_317647.4.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]