SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AGAP009937-PA|hypothetical from Anopheles gambiae VectorBase AgamP3.6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP009937-PA|hypothetical
Domain Number 1 Region: 398-796
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.79e-131
Family Ankyrin repeat 0.00000000129
Further Details:      
 
Domain Number 2 Region: 40-416
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.27e-109
Family Ankyrin repeat 0.000000174
Further Details:      
 
Domain Number 3 Region: 1410-1497
Classification Level Classification E-value
Superfamily DEATH domain 1.51e-19
Family DEATH domain, DD 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AGAP009937-PA|hypothetical
Sequence length 1520
Comment protein|protein_coding|3R:45691228-45703921:1|gene:AGAP009937
Sequence
NDTNTAFLRAARAGDLQKLIEYLETGQVTDINTCNTNGLNALHLAAKDGHYDIVNELLKR
GALVDNATKKGNTALHIASLAGQKEIIQLLLQYNASVNVQSQNGFTPLYMAAQENHDECV
NYLLAKGANPALATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVK
AAKLLLENEHNPDVSSKSGFTPLHIAAHYGNVNVAQLLIEKGADVNFTAKHNITPLHVAC
KWGKLNMVKLLIANHGRIDSITRDGLTPLHCAARSGHDQVIEVLLEHGAEIISKTKNGLA
PLHMAAQGEHVSAARILLMNKSPVDDITIDYLTALHVAAHCGHVKVAKLLLDRNADPNAR
ALNGFTPLHIACKKNRIKVVELLLNHGATIGATTESGLTPLHVASFMGCMNIVIYLLQHD
ASPDIPTVRGETPLHLAARAKQTDIIRILLRNGAYVNAQAREDQTPLHVASRIGNMEIVM
LLLQHGAKIDAVTKDNYTPLHIAAKEGQDEVAALLLDSEANVEAVTKKGFTPLHLAAKYG
NLKCAELLLERGAQVDVQGKNGVTPLHVASHYDHQKVALLLLEKGASPYSPAKNGHTPLH
IASKKNQLNIATTLLDYKADANAESKTGFTPLHLSAQEGHGDMARVLLDNGADPNHAAKN
GLTPLHLCAQEDHVGIAETLLEHKARIDPVTKTGFTPLHVAAHFGQAGMVKYLIENDANI
EMKTNIGHTPLHQAAQQGHTLIINILLKNKANPEAVTNGGQTALSIADKLGYITVVETLK
VVTETSVTQTVDEKFKIVGPETIHETFLSDSEDEGEDPIMSDQQQYNYMTSDENKQFDDT
NLTNMSIDPLKDDKYLEKIISRAENYTVSAMDRSHTPNPLDITVTDNVNITRKPIHVGFM
VSFLVDARGGAMRGCRHSGVRVIVPPRSAAQPTRITCRYVKPQRITNGPPLMEGEALVSR
ILELAPVGAKFLGPVILEVPHFASLRDKEREIIILRSDNGETWREHTLYDSEEAIHEVLN
ETFKGDTLNLLEDLHTNRITRIVTNDFPHYFAIVSRIRQEVHAIGPEGGTVSATAVPQVQ
AIFPQNALTKKIRVGLQAQPIDMNTTANLLGRSVAVSPVVTVEPRRRKFHKAITLSMPAP
KAYNSGMINQYSGNAPTLRLLCSITGGQNKAVWEDVTGSTPLTFVNDCVSFTTTVSARFW
LMDCRNIGEATKMATELYSQMAHVPFMVKFVVFAKRVDQSEAKLSVFCMTDDKEDKTLEH
QEHFTEIAKSRDIEVCEGRTVYLEFAGNIVPVMKSGEQLSLQFNAFKENRLTFTVKIKNN
LDDLLGRISFMNEPKVAKGEPIQTPLCTLNFTLPSEKFGLGGDDLETTSEFDQSSTEVLN
SEQQAVVAAANRGKTLNFTFQNGDGGSEIHKADIKITDICNLLGSDWPLLADELAITPSD
VELIRAEYPNDEPQQAIVMLRLWLRQAGRDATGNVLEQALIKINRPDIVNKSITNLEPVT
DEYERRVAQRQIGSMNGLDE
Download sequence
Identical sequences A0A1W5C970
AGAP009937-PA|hypothetical 7165.AGAP009937-PA XP_319063.4.40869 AGAP009937-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]