SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gene20327 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene20327
Domain Number 1 Region: 11-172
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-23
Family Protein kinases, catalytic subunit 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gene20327
Sequence length 224
Sequence
MEIEASSLVLVKQGAEARVFESTFVGRRSIVKERFSKKYRHPTLDAKLTLRRLNAEARCM
TKARRLGVYTPVLYAVDTVLHTLTFEYVEGPSVKDVFLEFGLGGGGVAAERMDDIAMQIG
QAIGKLHDGGLIHGDLTTSNLLIRAATDQVVVIDFGLSFTSTLPEDKAVDLYVLERALLS
MHSSCGNVMDRILAAYRKSSKQWSSTFNKLAQVRQRGRKRTMIG
Download sequence
Identical sequences gene20327 XP_004290621.1.20112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]