SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gene20770 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene20770
Domain Number 1 Region: 24-82
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000222
Family alpha-D-mannose-specific plant lectins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gene20770
Sequence length 156
Sequence
MVVILCFFTLLIQKVVPVIPVLLIATLLDSGNFILQQVNSDGSTKRVLWQSFDHPGDTLL
PGMKLGVNHKNGHIWSLTSWSSLYSAEPGAFTLDWDPGEHHLKIKQRGKGTWSSGVFTNG
RFEFLIPDDDSKKMRYNFSIVSNENEDYFTFNYVDD
Download sequence
Identical sequences XP_011471054.1.20112 gene20770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]