SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gene22143 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene22143
Domain Number 1 Region: 3-160
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.91e-26
Family Protein kinases, catalytic subunit 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gene22143
Sequence length 182
Sequence
MHHDCLPPIVHRDISSKNILLDSEYAACVLDFGTVKFLNPDSAIWTAPELAYTMEVNEKC
DVFSFGVMALEITMGRHPGDLLSSLSSGSSSASSSTALPVHPMSVLDILDQHISLPTHQV
AEEVLLVMKIAFACLNSGPRFCPTMKQVSQQFESLQRLHLSKPLRMITPGELFTLDGLAL
AT
Download sequence
Identical sequences gene22143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]