SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gene32063 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene32063
Domain Number 1 Region: 2-209
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.39e-35
Family Protein kinases, catalytic subunit 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gene32063
Sequence length 212
Sequence
MFWTEVTTIGKILVRIWGYCSENKHRLLITEYIENGSLDKQLFPPCFLAWKERFKVAMGT
AKDNDFEPKISDFGLSKLSQRGSRGSHFSQMRGTKGYMAPEWVSNLPITAKVDVYSYGVL
ILEIVKGIRLSNWVVEEDEEIETELTRFVRVAKHRIQCGEESWIEDMLDPRLDGVYSRSQ
AAKMVEIGISCVEEDRSKRPTMDAVVRMLLEC
Download sequence
Identical sequences gene32063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]