SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gene02009 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene02009
Domain Number 1 Region: 134-281
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.8e-20
Family alpha-D-mannose-specific plant lectins 0.0038
Further Details:      
 
Weak hits

Sequence:  gene02009
Domain Number - Region: 442-469
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.1
Family Pan module (APPLE domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gene02009
Sequence length 490
Sequence
MVGRFLKRRTRGGGCGGSQCQVSVCEGARACVVGMGSRGTLVILKVLPPRLLSYLCAIKL
GKWTMGPNYLSKKKFVFATLQGDNVVVATEGKDHETTLDTITKDDPIKDDGSAGLVSAGG
KFELGFFSLNAIGRYVGIWYHQLTPMTLVWVANRDNPLLANQTGVLAINRGTLQLLDNTS
GKSLWSAEIKVIVTQAFNRTVKLKDDGNLVLSDEAELGIVLWQSFQNPTDTFLPGMIMDT
SLNLTSWSGADDPRTGNFTFKLVEDNQYIIKKSATDYWRSGAPNDNFFSSDEMPAAVAYL
LSDFSDSYLKKGSGRIFQHNDSSYKQIAVLPRSEYNSTRLVMDYTGKLNWLVHKHNYWSP
TWLEPIDNCSVYNPCGYFGPSCNSTNSPICKCLHGFKPQLPNKWDLGDFSGGCIRESNLC
ATTATNDTFFSLKVKKVQKPDSETSAANETECRNKCFNDCKCVAYSYVDTLIVKSEIGLL
LVRVSHGLRN
Download sequence
Identical sequences gene02009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]