SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gene13809 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene13809
Domain Number 1 Region: 169-297
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.7e-18
Family alpha-D-mannose-specific plant lectins 0.0046
Further Details:      
 
Weak hits

Sequence:  gene13809
Domain Number - Region: 443-475
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0267
Family Pan module (APPLE domain) 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gene13809
Sequence length 551
Sequence
MLSHGQTVYMSPEYSQVLNSSVQMSNPTIIPHLYNINDPEQNKSSSPFSKSSSIPTPAHL
FPSLSSPINFCHKNLNACFANPPSLFPLMLLYYYLFISLTLFVTHGSSKPEIHIGYNLTL
AVPVEYTMGFIGRAFLMDTNPTIPSFRAALSVEAYNGKYSCSFQVFLGNVKVWSSGHYSK
FYTSNVCVLELTNDGDLRLKGPKDRVGWRTGTSGQGVERLQLLRTGNLVLVDGLDRIKWQ
SFNFPTDVMLWGQRLSVASRLTSFPSNSSSYYSMEIEHSKIALYLNTGKKNYSYWEFKPS
KNRNIAFIQLGLKGLELYSDKGKKIAQINPSEETIQPLRFLALGNETGNLRFYFYSPSLA
KFDASFQALNTTCDLPLACKPYGICTASSACSCIQVLTTKNETSTGTSGCIEGISSDGFC
GRGKAEMLELESVTSVLRGDSKIVNVSKEECGNLCLEDCKCASALHNSEECFLYGMVIGV
KQVERGRQLSYMVKVPKGFSHGGHGKSNVKKWVLILVGVVDGVIVLALFGGLGYYLIRKR
RRHSLPNGHNN
Download sequence
Identical sequences XP_004305099.2.20112 gene13809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]