SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gene15221 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene15221
Domain Number 1 Region: 853-1195,1298-1342
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.75e-68
Family FAD-linked reductases, N-terminal domain 0.0000217
Further Details:      
 
Domain Number 2 Region: 1177-1288
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.96e-28
Family L-aminoacid/polyamine oxidase 0.00035
Further Details:      
 
Domain Number 3 Region: 597-691
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000654
Family SWIRM domain 0.048
Further Details:      
 
Domain Number 4 Region: 1427-1512
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0000968
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gene15221
Sequence length 1909
Sequence
MEGDEKRLGAKKRSKLMKVNHNSDGDDEPIGSLLKKRQRNPKKVKPGLEGERGKKVEAGE
EDLGGLDDTLASFRKKLKGPKKDSGARGRSSSLDVVQSSDQDGGSDVKSVSRSAEKGLVT
GDDNGCDVIRDVEAENKLKGKGKRPKVSGLVSGEGSNSSLDHQLQDSLSAFFPKAQSSVN
KMSHPSSSLREKSGSQDLEDGLSPSSEGVGGNSMPVAVQGHGSVSKLTHEKPRFDDSLLS
DSGLDPFGSVIDQNKIEERNRVSQDSDCNRQNQERSQGLCSIPDEMMKLEDRKNEPTVDP
SGLNVQEEPCSLDKSNVSDSQHLQKTQTVENRMRHCSVTNSSTLTSWELKGEMPGVGNSD
SKGGFDDALSIQSTDVLARCTSGADCEISSSAGKQILMPHYNDDLLNKSNSSPNALKREE
TTRDCGTAYTEGHDLDSSHLQEENVIIADCQISSIQFIHQAKALQTASIQKASYCEDLSS
DEASKERIIPKHDYITGNEEVDGASPPLYAMLDVNESFPEDSVSQPDIENKDSKLSAILR
APRNIRKRRHGDMAYEGDVDWEISTNDQGLDSDNSIRARVKLDSSSSIGTEAESGGAAAV
SAGLKAHAVGPVEKIKFKEILKRRGGLQDYLECRNQILALWSKDVSRILPLTDCGVTESA
CVDEPGRASLIRDIYAFLDLSGYINVGIAAEKDKAEPGSKHDYKILREKPFEEISGVSVA
DSEDGVSFIIGQVKNSKASTDAKNGITFNSENLTEGAPKDNGHVGAVALELLDVKNPAEC
QTDYLENCSADVRFQSRLDNMDVSSSDPSGETLDGGVVPVVTPEIKHESQSIQSTPYDHL
PSNNTLQCGPEVRKEIIVIGAGPAGLTAARHLKRQGFSVNVLEARSRIGGRVFTDRSSLS
VAVDLGASIITGVEADWATERRPDPSSLVCAQLGLELTVLNSDCPLYDIETGQKVPAELD
EALEAEFNSLLDDMVLLVAQKGERAARMSLEEGFEYALKRRRMAQSGSAKEKELHGSRDD
GRTNIDGRVADKSCSKQELLSPLERRVMDWHFANLEYGCAAPLKEVSLPHWNQDDVYGGF
GGAHCMIKGGYSTVVESLGEGLRIHLDHVVTDISYGAEDGELNNNQRNKVKVSTSNGSIF
CGDAVLVTVPLGCLKAETIKFSPPLPQWKHSSITRLGFGVLNKVVLEFPDVFWDDSVDYF
GATAEETDLRGQCFMFWNIKKTVGAPVLIALVVGKAAIEGQNMSSSDHVNHALVALRKLF
GEASVPDPVASVVTDWGRDPFSYGAYSYVAVGASGKDYDILGRPVNNCLFFAGEATCKEH
PDTVGGAMMSGLREAVRVIDILTTGHDYTAEAEAMESIQSESASEKDEVRDITRRLDAVE
LSSVLYKNREALLQDLFFNAKTTKGRLHLAKELLTLPAETLKSFAGTKEGLTTLNSWILD
SMGKAGTQLLRHCVRLLVLVSTDLLAVRLSGIGKTVREKVCVHTSRDIRAIASQLVSVWL
EVFRREKASNGGLKLSRQASGVDSLKRKTVRDSSSGKPPLHLYHGAFEHKGSLQDSASTG
SQLPSNSNAKKMNGKTIRLETANSSRFGGSTGKPHDDEFAMTEEERAAIAAAEAARAAAL
AAAKAYASSEAKSSSLLQLPKIPSFHKFARREQYAQMDEYDFRRKWSGGVLGREDCISEI
DSRNCKVRNWSVDFSAACVNLDSSRRSVDNLSERSHPNEITSQLNFREHSGESAAVDSSI
YTKAWVDTAGSVGVKDYHAIEMWQSQAAAADPDFYHPDPYVKDEEDSNTTSKGLSWKHDG
LVNESSVSQVTVNKGSSKNHRRGADQIKHAVVDYVASLLMPLYKAKKIDREGYKSIMKKS
ATKVMEQATDSEKAMAVSEFLDFKRRNKIRAFVDKLIEKHMAVKPGVKS
Download sequence
Identical sequences XP_011459530.1.20112 XP_011459531.1.20112 gene15221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]