SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gene17726 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene17726
Domain Number 1 Region: 473-726
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.65e-40
Family Protein kinases, catalytic subunit 0.0015
Further Details:      
 
Domain Number 2 Region: 81-164
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.85e-19
Family alpha-D-mannose-specific plant lectins 0.0037
Further Details:      
 
Domain Number 3 Region: 173-277
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000393
Family alpha-D-mannose-specific plant lectins 0.0068
Further Details:      
 
Weak hits

Sequence:  gene17726
Domain Number - Region: 339-388
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0129
Family Anti-platelet protein 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gene17726
Sequence length 740
Sequence
MLQQEGLLFRSSFLLTIFARFVLHSLALSEIPLGSKLSALDTNIWASPNGDFAFGFFNRT
DDANYSVGIRFNSKSIPPGKQTLVWTAGANIMVGEKSYVQLTQDGELVIIDSLKGVAVWS
SKTSQLSVVSAALHDNGNLVLLNGEKHIVWQSFNTPSDTLLPGQNFSRSQMLRAASKNLV
SDYMSSYYTLFMNAYGQLQLRWESHFVYWTSGSAPSSNLTAFLTSEGALQLRDQNLKTVW
SMFGEDYNDSLSYRFLRLDVDGNLRLYSWREASMTWRAVWQAVENQCNVFATCGQRGICF
FTESGLPDCKCPFNPVNGSTEKCLIPSQQCESSSSLFSYKHTVLYGMYNSTDDLVVRTSL
QQCRSLCLKDPLCTAATFSNDGTANCLMKRKQYVTGYSDPSLSSVSFVKVCADPLAVNPN
LSLSSPSANKFCLPCLIGAASVAVFLLFQLALGLWFFRRRNLVRKKPSFACTSSSSNGLI
VLSISEIEDFTENFKHQIGKEMYKAVLPDKESVAIRKMNTSSEEREYRSAVSLIGGIHHK
NLVKLQGYCCELNHRFLVYEYVKNGSVDRYIEDHKLCKRLTWGKRVDICLSVARAVSYLH
TSCRKCIIHGTLKWEDVLLDENLEAKVTGFGVGTIVGNESCSSAMRDVEDFGRMVLVLVS
GCREVGDLCEWAYKEWSDGHPENVVDRRLSGMHLTQELERVLRIAFWCLQTDEHQRPSMT
EVVTLLAGTSSVDPPPPPFA
Download sequence
Identical sequences gene17726 XP_004303106.1.20112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]