SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gene18555 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene18555
Domain Number 1 Region: 507-790
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.19e-76
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 72-194
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.96e-22
Family alpha-D-mannose-specific plant lectins 0.0055
Further Details:      
 
Domain Number 3 Region: 177-237
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000144
Family alpha-D-mannose-specific plant lectins 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gene18555
Sequence length 811
Sequence
MASTSVICVCLLCLCCLSEGAQQQHNSSQIARGSSLSPITHPSSWPSPSGKFSFGFYQQG
SGFAVGIWLEDISQKTVVWTANRDDLPVASSSVLQLTEHGELVLLNERGQKKLIVSNSIN
ELVSFASMLDSGNFVLYNERSEVIWESFDYPTDTILNGQTLPVGGQLYSSLSEADHSTGR
FHLKMQGDGNLVLYPANTEDWITDAYWSSNTFNIGINFHLYLDPTGTLVITNTTTIWKYS
NTYRVIYDGSKNGYKNGTMYRAIVGVDGNFRLYSHGSDDNNGKLQPFVFMWSAIDKPCQV
KGLCGLNSYCTLDDDQPSCLCLPGSNYVNMDRKMLGCLRNYTEVECQGGKVNISNYQMST
MNNMMWGGTDYAEEEMLKEECSRSCLEDCNCGAALFQDGYCTKQNLPLKYVRRDLDESTI
AFFRVGMITSTESNNQTDQFPTTVNPFMEVDSTSKKLLVQVLVITLGFIIFICVALAISG
FYIFKIRVLHYKRLTEVNGNLGLADEELTLRVFSYNELKRATNGFKQELGKGSFGAVYKG
ALNKGKKLIAVKRLEKLVEEGEREFRAEMQAIGRTHHKNLVRLLGYSAEESKRLLVYEYM
SNGSLADLLFRAEWHPAWDERVRIAVDVARGLLYLHEECKSPIIHCDIKPQNILLDESWN
AKIADFGLAKLLMPDQTRTFTGIRGTRGYLAPEWQKNTPISVKADIYSFGVVLLELVCCR
RNLDVSVRAEEIVLSTWVYKCFVSRALHKLIVGGEEVNKKSLENMVKVGLWCIQDEPALR
PSMKSVVLMLQGITDSIYPSMSNHCFYVINH
Download sequence
Identical sequences gene18555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]