SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gene20589 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene20589
Domain Number 1 Region: 14-166
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 5.62e-40
Family Toll/Interleukin receptor TIR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 296-436
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.18e-24
Family alpha-D-mannose-specific plant lectins 0.003
Further Details:      
 
Domain Number 3 Region: 1114-1307
Classification Level Classification E-value
Superfamily HCP-like 0.0000000562
Family HCP-like 0.037
Further Details:      
 
Domain Number 4 Region: 407-494
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000877
Family alpha-D-mannose-specific plant lectins 0.0046
Further Details:      
 
Weak hits

Sequence:  gene20589
Domain Number - Region: 767-824,861-963
Classification Level Classification E-value
Superfamily HCP-like 0.00102
Family HCP-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gene20589
Sequence length 1737
Sequence
MASSASLPSSIESSSSSAARPCKYDVFLSFRGLDTRRGITSQLYDGLQNKRGIATFMDDQ
NLEVGDAISPTLIKAIEESWFAIVVLSPNYASSTWCLEELAKICEWMEGNKRILPLFYNV
EPTDVRYQKGSFEVAFSKYESSQRHRLVEVQQWRKALNKVASFSGWDSKIYKTDTELVEK
IVDFVVKKRRDDNVTPIGVYGMGEVRKNGNSTEIVACERDPNPVYPVKQALPPASTQTKK
RRRASRLYKEIMRKDNIRIGGIAVGASLSTAGNSPWISPSGDFAFGFRQLENNDLFLLSI
WFAKIPDRTIVWYANGDKPAPNGSDVTLTANSGLVLTSPQGEQLWKSNQTTAGVVAHAVM
NDTGNFVLEDEKSEILWETFKNPTDTMLPGQILERGGKLSSRRSETDYSRGSFQLDFQDD
GNLVFTDEKPFYSTKTTSGTVPGSEGRQLVFNASGDFYILRVNGGHYTFTTEERAAGDYY
LRSTLSFDGVLAQYFHPKTSSRNITWVPLWSAPGRAVLKDRKPTCHDKQAYLHSMLPSKT
KQLCQISHTISKFRAFQAGPSHNVRSNLKENGFRNRAQTSGSEMEKSIYSILTIDRWESL
NHMEYRLASLRPVHGRLALKFFNWVIQQPGLELNHLTHVLSVTTHILARARMYDSARLIL
GHLAQMGVGSKSVFDALMDTYPLCNSNPSVFDLLIRVYLKEGMVGSAVETFYLMGLRGFR
PSGCTCNMILASLAKDRRAASVWSFFKEMLAKNVCPDVSTFNILISVLCVEGKLSKASYL
LRKMEKSGYVPNVVTYNTLLNWYCKKGRYKAAFELIDLMGSKGIEADVCTYNMLIEDLCR
NSSSAKGYLLLKKMRRKKLSPSEVTYNILINGFVKEGKIGVATKVFDEMSKFDLSPNCVT
YNALIDGLCQKGKLEEAFRLLDMMEAVGLRPNEVSYGAVLNGLCKHGKFDLARSTLQRVR
LNGIGSGCVMYTSFMDGLCKNGLLDEAVHFLNVMIQDGVNPDIVAFSVLINGLCRAGRMK
HVGEIMCKLYRAGLAPNKIIYSTLIYNCCKMGNVMEALKIYAVMNRNGHSADHFICNILV
TALCEAGNLGAAENFMRHMSSMGLVASSISFDCMINGYANMGNALGAFSVFDEMIELGHH
PSPFTYGSILKGLCQGGHLEEARNFLKKLHSIPYAVDTVVYNTILSETCKSGNLHEAVVL
LDQMVENNVLPDTHTYSSLLAGLCRKGKMVTAILLFGRVMEKGILSPNAIMYTCLVDGLF
KIGQSKAASYLFEEMENKGLNSDTTALNVMMDGYSRMGKMMKANDLFSSMGSRKLFPNLA
SYNILLHGYSKKEDLLACSMVYKNLIRIKLLPDRLTCHSLILGLCESGKVDIGHKMLHKM
IIEGAVPDLLTFNLLISKYSEIGKMGMAFELVSVMNLLGVSANTDTHDAILNGLFRSLAF
RASRSLLYEMLAKGYTPKYTHYFTIINGMCRVGDIKGAFELKDQMEALGVTSRDIAESAM
VRGLAKCGKVEEAMLVLDHMLRMQLVPTTATFTTLMHKFCKEANLAEALKLRGVMEHCGV
PLDVTAFNVLISGFCANGDVAAAFELYKEMKQSGLFPNTTTYTLLLAAVFSGNNLIEGEE
IFVDLLERGLICGNLDGRTLTLHEQLNDKGRPLPKFGEWDVNDPASAEGFTVIFNKARDE
KKTGGKPESPSKADQSNVRPGVDPGRPSSPASPPVSFKINVAKFLYGTIVGNRQKEL
Download sequence
Identical sequences gene20589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]