SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gene21088 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene21088
Domain Number 1 Region: 68-203
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.7e-19
Family alpha-D-mannose-specific plant lectins 0.0057
Further Details:      
 
Domain Number 2 Region: 150-269
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000929
Family alpha-D-mannose-specific plant lectins 0.0028
Further Details:      
 
Weak hits

Sequence:  gene21088
Domain Number - Region: 519-562
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0114
Family Protein kinases, catalytic subunit 0.014
Further Details:      
 
Domain Number - Region: 340-380
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.051
Family Anti-platelet protein 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gene21088
Sequence length 571
Sequence
MAFLVACLLAFAFILNAEAQSAPSNISPGSSLTPNSNSSWLSSSGVYAFGFYKQGDGYAV
GIVLAGMPEKTVVWTANRDDPLVSDNATLLLTADGLSLQPTQGKPLVTSITQAVFSASML
DSGNFVLYNSDQEIEWQSFDSPTDTLLPNQTLRAGEELYSAKSKTNSSTGIFRLSMQRDG
NLVQYPVATTAATTDDAYYATGTYLRGDNVTLHLDADGHLYLVNNTGFTIFNLTKGGDPA
DQGKSYLMRLDVDGIFRLYSYSLKQNGNWSIEWESSLDQCNPLGLCGYNSYCVTMDLEAE
CKCLPGFEPITPGDQTSGCGRNMVADVCNSENENFTCIMQELPNTRWKNYAYMTLSLSDK
EECNKACLEDCNCEAALFADGSCRKQRLPLTYGKRKLDTSNSAFIKVGISKTPATDDFLI
EGSKKNGRVVVLILGVSFTAFGTILLVSSVIAVWKHKVWGYKRMNQLNGDVEWNEEDVAP
RPYANVDWSLPQEEAILDELVYHYFESGELSKLVRDEDINRRQFERAIKVGLWCIQDEPS
LRPSMKKVLLMLEGTVDIRVPPNPSSFLSTI
Download sequence
Identical sequences gene21088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]