SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gene21089 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene21089
Domain Number 1 Region: 482-766
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-75
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 59-144,173-207
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.04e-18
Family alpha-D-mannose-specific plant lectins 0.0053
Further Details:      
 
Domain Number 3 Region: 168-273
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000158
Family alpha-D-mannose-specific plant lectins 0.0047
Further Details:      
 
Weak hits

Sequence:  gene21089
Domain Number - Region: 281-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0191
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 357-384
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0369
Family Hairpin loop containing domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gene21089
Sequence length 784
Sequence
MAFVVCYLLAFAFFNYAGAQQLQSNISRGSALTPTTNSSWLSRSGMYAFGFYKQGNGFAV
GIFIAGIPEKTVVWTANRDGRLVSDNASLLFTSDGIALQSTQGQSLVVDAPVLVSSASML
DSGNFVLYNASRAIVWQSFEYPTDTLLPNQPLIAGIAGKELVSAKSETDHSSGTFRLAMQ
GDGNLVQYPVDTGPDGGTQYAYYASNTFTAGPNVSLNLGVDGRLFLLNGTGDGNLLNLSL
GGLPTQGRSYLMRIDADGIFRVYSYDLKQKGNWSTEWSSSQDRCDPQGACGYNSYCVTMG
AAIDCICLPGFEYVNAGDQTLGCERNSSVGDVCKSKNWNCNYTMQELGSTKWEDEPYMVL
KPSGKEDCKQACLGDFNCQAAVFDGLSCSKQRPPLRYGRRDESTSKILLLKEVVMSSAPP
APRAVVPKRSRKNGRNLFLIVGVSFTALGFILLVISVTVLWKNNVWAYKRMSEVNGDAEW
NEDVTPRPYAYEDIEKMTNNFNEEVGRGASGTVYKGVIGNSQKLVAVKRLEKVAAEGDRE
FQTEMRVIGRTHHRNLVRLLGYCLDGPKKLLVYEYMSNGSLADILFTPERKLHWEERMGI
ARKIARGFLYLHEECDTQIIHCDIKPQNILMDEYMCPKITDFGLSKLLQPDETQICTGIR
GTKGYVAPEWHRKIPVTVKVDVYSFGIVLLEIVFCRRNVDWSLPHDEAILDELVYHYFES
GELRKLVGDEDMDSRQLERVVKVGIWCIQDEPSLRPSMKKVLLMLEGTVEIPVPPSPVSF
LSTI
Download sequence
Identical sequences XP_004289248.1.20112 gene21089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]