SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gene26853 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene26853
Domain Number 1 Region: 71-205
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.58e-18
Family alpha-D-mannose-specific plant lectins 0.0079
Further Details:      
 
Weak hits

Sequence:  gene26853
Domain Number - Region: 282-331
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0408
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gene26853
Sequence length 364
Sequence
MDSLYALSLSFAILWLSLLPVLTASNLNHYITPNFTANRIQFVETSGAFLESLNGTFRAS
ISTADSIQSLFYFSVIHVASNTIIWSANRNAPVSYSAMHSLTIHGLGITDDLNRVVWSTP
SFNSKVAALQLLETGNLILVDAHNVSLWNSFDSPTDTLIIGQRLYPGQSLTAAVGNNNLS
VGDYKLAVTSEDLVLRWRGQTYWKLSMESKAFKNSDTPVSYVEMSRTGLYLFGADGLKAV
FQVFLEPSDTKIARLGYEGIFSIISFIGSKWVQDFVKPVDICQRPFTCGKLGFCSNQSPT
CICPTGFHNGAQEHDACVPIQDTISLPSSCNGSGNTSEFNSSTVYIELQKGMDYFGNHFN
QPDS
Download sequence
Identical sequences gene26853 XP_011465742.1.20112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]