SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gene27255 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene27255
Domain Number 1 Region: 92-169,198-218
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.14e-26
Family alpha-D-mannose-specific plant lectins 0.0027
Further Details:      
 
Weak hits

Sequence:  gene27255
Domain Number - Region: 404-435
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000549
Family Pan module (APPLE domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gene27255
Sequence length 452
Sequence
MVSHAAFLLLLFLLGSFFAIPSQAQVPANQTFIFVNQGELGDRIAEFKASYLVIQTKAHT
FYTHPFRLCFYNTTPDSYFFAIRMGVPNDEGLMRWVWDANRNHPVHEKATLSLGRDGNLI
LADADGTVSWQTNTANKGVTGIKLLPNGNLVLHDKNGRFIWQSFDYPHDTLLLGQSVKNI
TGHNKLISRKSDADGSDGQYSLALDRSGFTMYLNNSGQLLTYGGWPNTNFGSTVTFDLDT
ANGFDDVILYELVLKGNQNIDAAPQNRRRLLQTRPIGNANTLNLNKLNHDAKYSFLRLGS
DGSLKAYTYYNEVSNQKWDESFSFFSSYFVRECALPSKCGSYGYCSNAMCVGCPSPKGLR
GWSKACVPPKLAACRSGAKANYYKIGAVEHFLSPYLDGGDGPMKVEECRAKCDKDCKCLG
FFYREASSKCLLAPVLGTLIKEVNTSVGYIKY
Download sequence
Identical sequences gene27255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]