SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gene27503 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene27503
Domain Number 1 Region: 87-191
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.62e-19
Family alpha-D-mannose-specific plant lectins 0.0023
Further Details:      
 
Domain Number 2 Region: 154-258
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000544
Family alpha-D-mannose-specific plant lectins 0.0075
Further Details:      
 
Weak hits

Sequence:  gene27503
Domain Number - Region: 452-561
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0176
Family Protein kinases, catalytic subunit 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gene27503
Sequence length 607
Sequence
MAIKKSHLLLFPLFCLLLFQTKPIWAATIPPGSSLFASNPNQTWSSPDSTFSFGFFPADP
PTSPPSLLAAISYSGALPIWSAGSVDSAGALHFLSSGSLRLVDGSNRTVWDSNTAGRGVS
SALLDDSGNLILRNGTDDVWSSFDNPTDTIVPSQNFTVGKVLRSGMYSFKLIKNGNLTLL
WNDTIVYWNQGLNSSVTSNTPNLTSPNLELQPIGILTISDPKLPTAAIVAYSNDYAEAGD
ILRFLKLESDGNVRIYSSAKGSGTKTERWAAVTDQCQVFGYCGNMGICSYNDSNPVCGCP
SLNFEPVDPKDSRQGCRRKMEIEDCPQSVTMLDLDHTRFLTYPPETDSQIFFVGISACRL
NCLVNNPCDASTSLSDGTGLCYYKTPGYLSGYHSPALTSSSYIKVCGPVVLNPPSSMDSS
GKKKGWKMGAWIVVLVVVASLLGLMALEGGLWWWFCRNSPSFGALSAQYALLEYASGAPT
ERKKFSIWVFDEFEKGNIRGIIDKRLADQDVDMDQVMRAIQVTFWCIQEQPSHRPMMGKV
VQMLEGITEIGKPPSPRAIIEGPVCGTSTSLVAPSSISSFQISGASPSEQVRKMEKATAS
LIQSDLS
Download sequence
Identical sequences gene27503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]