SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gene30150 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene30150
Domain Number 1 Region: 92-200
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000000851
Family alpha-D-mannose-specific plant lectins 0.0053
Further Details:      
 
Weak hits

Sequence:  gene30150
Domain Number - Region: 364-405
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000314
Family Pan module (APPLE domain) 0.074
Further Details:      
 
Domain Number - Region: 251-284
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0497
Family alpha-D-mannose-specific plant lectins 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gene30150
Sequence length 498
Sequence
MEIHSHFISLVTRLRATQLLLCTLTILLFTSTTSTTAATLSELPRGFKATPDSSTETFQP
LLSDSTGNFSLGFLRVNKTQLALAILHVPSSEPFWLANPTKLARWSDRAQLTFNGSLILT
DPHTKLYWSTHTNADRVILQNNSNLLVQSSNHTEPAAWESFDFPTDTLVENQNFTSKMVL
ISSNGLYYMRLGPDFIGLYANFNEGSDQIYLRHKAMEAKTEIVENQAPIYAQINPDRYLG
MYQTGNPLPADVQKFNSFQTPVTGFLRVRLEPDGNLIGYFWDGTKWVLDYQAISQTCELP
SACGSYGLCTAGNGCSCLDNRTEYASGECFAAQSGDFCSDGVPRNNFWVLRRNGVEPPYK
ELMRYETTSSVKQCESLCERNCSCWGAVFNNGSGFCYMMDYPVQSLVGVGDETKMGYFKV
REGAGRKKVNVGAGVGIGVMCGVVLILVGIVVVWRFRVWKRKRGAVKSRFMEQNGGVSPG
PYKDLGTASFRSIEMGST
Download sequence
Identical sequences XP_004303024.1.20112 gene30150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]