SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gene30631 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene30631
Domain Number 1 Region: 623-911
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-79
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 199-303
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.66e-22
Family alpha-D-mannose-specific plant lectins 0.0035
Further Details:      
 
Domain Number 3 Region: 67-137
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000236
Family alpha-D-mannose-specific plant lectins 0.0072
Further Details:      
 
Weak hits

Sequence:  gene30631
Domain Number - Region: 493-545
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0157
Family Hairpin loop containing domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gene30631
Sequence length 956
Sequence
MPIGVETSSVRVLNTYMFFLLIFSLLPSQYWAEVYNVTSSQPLAQGQTLVSPSQVFELGF
FSPNSSANMYVGLWHKSIFPRKIVWVANRENPLAVKDTLATLRIGSNGNLDLVDGKQSSV
WSTNVSVSTNGSAAVLFGHLLPSQYYGAEVYNITPSHPLAEGQTLVSPNQIFELGFFRPY
SSAHKYVGLWHKSIFPRKYVWVANRDNPLAVTDTLATLRIGSNGNLELVDGKRSSVWSTN
ISNCSSAALLDSGNFVVKDVMGGVMWESFTNPSDSLLPKMALGYDSGSGKKNFLKSWRSE
HDPSPGLFLAGLSAELPAQLTVWSSGSTRHWRSGPWDTSKFVGVPTMNTLAINPFSLDDN
VKKGTRYFSYSFDKIPGDTVLAYMDISSEGRMSFMFSEGGTNWDPQWLSSENLCDDYGAC
GPFGVCEASGSPICKCLKGFVPKSNEEWSKGNWTGGCVRRTSLSCETNTTKGKGDGFLKL
KRMKVPDFHKFLTTLAIDKFEQCTTQCLSNCSCLAYAYIDNIGCLVWYEDLTDMQLFPSF
GDDLYVRLAHSELGEGKPIGLIASLAAIGFLSILVAIVFSLHRWRANKKRHLELEVKAPP
LESTSMLKKNRDGLREYIGKHDPSELKIYDFDSILIATDNFSFANKLGQGGFGPVYKGML
PEGKEIAVKRLSSSSGQGVEEFKNEMLLISNLQHKNLVRMMGCCVNEDEKLLIYEFMPNK
SLDTFLFDPTKRAVLDWATRFNIIQGVARGLLYLHHDSYVKVIHRDLKVSNILLDEKMNP
KISDFGLARIVEETKDRDKTVKVVGTRGYMSPEYAMGGIFSEKSDVYSFGVLVLEIISGK
NNSFYLYDQHLGFLAYAWMLWNEGSGLEFVSDVLSSSYSSYEVLKCMQIGLLCVQDSASD
RPTMADVAFMLSSETEGPQPMRPVFTIENSVLPSQPHCENTNSSTNEATITVIEGR
Download sequence
Identical sequences gene30631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]