SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gene32655 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene32655
Domain Number 1 Region: 476-755
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-75
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 55-190
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-17
Family alpha-D-mannose-specific plant lectins 0.0042
Further Details:      
 
Domain Number 3 Region: 171-232
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000785
Family alpha-D-mannose-specific plant lectins 0.0033
Further Details:      
 
Weak hits

Sequence:  gene32655
Domain Number - Region: 280-314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0288
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gene32655
Sequence length 775
Sequence
MAAIFLLLLLLLQVAAAQQGNISLGASLYSNNNSHWLSDSGQFAFGFYSQGNDLHLGIWF
EKTNPKTIIWTATRDPLKQQSIPNDARLIVSVQGLELILKEKNAFPIPVSNSSQPVARAS
LLDSGNFVLYNSDSNVIWQTFDLPTDTIVAGQRLLAGKRLISSISNTNHGSGRFQVIMQR
DGNLVQYPTVPFTLTPDQYSYWASGTFGAGVNVSLNLDQNGELYLLNSTGSKIKSFFVQK
DLSMYLVYRLTIDAHGILWLYSCDLVKNDSWSIEWSSTDNKCAPLGLCGLNSYCVLVNQE
PSCVCLPGFVFIDGGQKYSGCKRNWSTFGCIGENETSYSIVDVDNIAWENAPYSVLSMNK
TACKEDCLMDCNCEAATFRDQLCRKQKLPLRFGRTRAPGLVTTFVKKGITDQSSGTKRMS
KGRTKVDTVIFVSSISTLTFSLVVMALTGVVIYRYRVLDDQKVSDSADEGLIGGVTLRSY
TYRELQKATKCFINQVGKGAFGTVFKGVIGGRVVAVKQLENVLDEEREFRNEMNAIGRTH
HKNLVKLLGYCHDGTNRLLVYEFMTNGSLADFFFKSNGGRPTWEERIGIALNVARGILYL
HEECDTQIIHCDIKPENILMSEQKCAKLADFGLAKLLKADHQSGTNTGFRGTRGYVAPEW
HRNLTISVKADVYSFGVVLLEIICCQRGMNMAIPDEVTLENWMYRCLEANELEKLVKDDE
IDTSKLREMVKLGLCCIQEKPSFRPSMKKVVLMLEGILEIPSPPNPFSSRVDETN
Download sequence
Identical sequences XP_004292535.1.20112 gene32655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]