SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gene35002 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene35002
Domain Number 1 Region: 72-186
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.13e-25
Family alpha-D-mannose-specific plant lectins 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gene35002
Sequence length 254
Sequence
MYRKALFLFLLFQFCTSRDTIKGNKEQLKDVDGDYLVSRESKFELGFFSPGNSCYRYVGI
WYSQTRVSEKTVVWVANRNNPINDTSGVLTINRYGELVLYAYSVENDPIWFANVSQSVQN
VNTSTLSAQLLDSGNLVVFQDDTNDIYMWQSFDHPTDTQIPGMKLGVNWKTGQEWVLTSW
KSQDDPGTGAITRTIVTDSAVKRLTWDDGKLQWKEDFSAPKSRCDWYGRCGANSKCSPDN
VNLFECECLPGYEP
Download sequence
Identical sequences gene35002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]