SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|337737335|ref|YP_004636782.1| from Clostridium acetobutylicum DSM 1731

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|337737335|ref|YP_004636782.1|
Domain Number - Region: 29-157
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0103
Family FCH domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|337737335|ref|YP_004636782.1|
Sequence length 205
Comment cell division protein DivIVA [Clostridium acetobutylicum DSM 1731]
Sequence
MDVRLTPMDINNKEFRRTLRGFDTEEVDQFLDQVSENYEQLYKENSELKERNSILKEKLA
HYEKIEDTIQNTLILAQNAAEQAKQSAKTESDLILKNANDTAQRIIDKANQDVIKINDDY
DNVKQQFMRFRAKYRNFMNSQLDMFNSLENDFESNYNVSTTESINEKEIEPESVKPSSVE
VESTFDDSDKSFADDLEEVKKFFVK
Download sequence
Identical sequences Q97H95
272562.CA_C2118 gi|337737335|ref|YP_004636782.1| gi|15895387|ref|NP_348736.1| NP_348736.1.94244 WP_010965417.1.17575 WP_010965417.1.17905 WP_010965417.1.48544 WP_010965417.1.57811 WP_010965417.1.63117 WP_010965417.1.71350 WP_010965417.1.92914 gi|384458844|ref|YP_005671264.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]