SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384459240|ref|YP_005671660.1| from Clostridium acetobutylicum EA 2018

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384459240|ref|YP_005671660.1|
Domain Number 1 Region: 57-374
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.66e-93
Family Glycosyl hydrolases family 35 catalytic domain 0.000000699
Further Details:      
 
Domain Number 2 Region: 388-558
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.08e-40
Family Beta-galactosidase LacA, domain 2 0.0018
Further Details:      
 
Domain Number 3 Region: 647-816
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.58e-40
Family Beta-galactosidase LacA, domains 4 and 5 0.0000635
Further Details:      
 
Domain Number 4 Region: 819-965
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.7e-36
Family Beta-galactosidase LacA, domains 4 and 5 0.00023
Further Details:      
 
Domain Number 5 Region: 561-642
Classification Level Classification E-value
Superfamily Beta-galactosidase LacA, domain 3 2.22e-20
Family Beta-galactosidase LacA, domain 3 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384459240|ref|YP_005671660.1|
Sequence length 982
Comment Beta galactosidase [Clostridium acetobutylicum EA 2018]
Sequence
MNNNFKKVLMCLLGVGIYISAVTFPSKIYADTIQKKISRNNNDSFTLPSSQGLKGIHNVS
YDHYSLMIDGKRIFLYSGEFDYWRLPSQSGWMDVLEKMKAAGFNAVTIYFNWGFHSPKQG
KYDFSGIRDVDKLLTMAQKIGLYVVARPGPYINAETDGGGYPGWLTTQQGRARTASQDYT
AAYEQWLSAIDPIIEKHQITNGGSVILYQVENEYTGGDALYMQNIRDKARKDGINVPTFH
NDKSGPKGRWSSGTGAPDMYAYDSYPGLAAIPSYYGDPRKFAPNSPVFLAELGGGWFDPW
GGKSYAILSKNYNANYENVLYNHVVSEGATMMSIYMTYGGTNWGYLPFPGVYSSYDYTAA
ISESRQLGSKYNEEKLLATMYRTLTPLTKTDPLTTIEAPSNPNLLANAIENSDTKTQFYI
LRHSNGSSISNDNTTLKIQSADGIYILPQEPGTSININGQESKFIVANFQLGSEHLVYST
SNLYTYVTQGNRDTAIFYGGQESDGETVLRYKNQPKVTVLCGNVKSRYDSVSGDLRLNYK
HDGSISRVMIKDDNKELMLLFTTDITAQTFWCEDTSIGEILVRGPYLVRSASIRDRNKLE
LQGDTDKASDIEVFAPTSVNEIKWNGEKVKALQTSYLSYTFSLLSPEQVLIPVITNWKYS
YETNEAQSEFDDSSWISANKTTTNNPVKPLTPTVLYADDYGFHHGVVWFRGHFKASGKET
GIILDGEGGTNGAYAVWINGFYLGASLSGIKNFTFPKNVLKTSDDNVISVMVQNMGHDED
GGCKDTHKSPRGLVQASLQGDTTSIFWSIQGNKGGETLIDPVRGAMNAGGLYGENNGWTL
PNFPDKPWKQVTLPDNGKQRGVAPGVSWYRTTFKLNFPKMSDVPLALYIKDNNTKNYRAY
IYVNGWLIGQYINSLGPQNLFSLPSGVLDPNGKNTIAIAVWALDNNSTGLGEIILQKLGN
YSGGVPVKMNDNPSYKDVFNKN
Download sequence
Identical sequences Q97G55
gi|337737730|ref|YP_004637177.1| gi|15895779|ref|NP_349128.1| NP_349128.1.94244 WP_010965809.1.17575 WP_010965809.1.17905 WP_010965809.1.48544 WP_010965809.1.57811 WP_010965809.1.71350 WP_010965809.1.92914 gi|384459240|ref|YP_005671660.1| 272562.CA_C2514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]