SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|376259942|ref|YP_005146662.1| from Clostridium sp. BNL1100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|376259942|ref|YP_005146662.1|
Domain Number 1 Region: 316-808
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 6.38e-135
Family Cellulases catalytic domain 0.0000000000958
Further Details:      
 
Domain Number 2 Region: 37-200
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.21e-30
Family CBM4/9 0.0045
Further Details:      
 
Domain Number 3 Region: 213-313
Classification Level Classification E-value
Superfamily E set domains 1.89e-21
Family E-set domains of sugar-utilizing enzymes 0.00065
Further Details:      
 
Domain Number 4 Region: 816-874
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000981
Family Type I dockerin domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|376259942|ref|YP_005146662.1|
Sequence length 877
Comment putative carbohydrate binding protein,dockerin-like protein [Clostridium sp. BNL1100]
Sequence
MKKRLVKKIAMLMAIVLILSTCVVQASAGEYEGAGDLIRNHTFDNGIGLPWRVVETYPAT
ANFDITADGKFKITVSKIGSAATGQRWDVQLSHRGLTLLQGHTYTVQFTVTADRDCLIYP
RIGDQGDPYYEYWHIGQWEFLQLKANQPTTVTQTFKQEKGDKSNVEFAFHLAPDRSMAPS
EYTGTFRPITFTFDDMYLKDPQFIGYPKTAPEPTNVVRLNQEGFYPNSDKIATVATSSTI
PINWQLVNSTGTVVFAGKSTIKGYDHASGNNVHIIDFSNYRTVGTGYKIVTDVPEANTSD
HPTDNESMPFNIGNDIYSKMKYDSIKYFYHHRSGITIEMPYCDQSQWARPAGHTTDILAP
DPTKDYSANYTLDVTGGWYDAGDYGKYVVNGGISTWTLMNSYERALYLGDTSVTPFIDGS
LNIPESGNGFPDILDEARYNLKTLLNMQVPAGNTLAGMVHHKAGDERWLELATRPDQDTM
KRYLQPPTTVATLNLAAIAAQGSRLWKQYDAAFATKCLTAAEAAWDAAVAHPNIYPPLSS
ALGGTYAETYFRDDFYWAACELYVTTGSQKYLDYIKSSPHYLQEPTELAGGEDIGPTGCF
DLDNTAGMGTITLALVPNGLPAADIAKAKDNIMAAADKFISIEQVQGYGVPIEEKKLSDT
LTGFPWGSNSFVVNNAIVMSYAYLFSGYNFNGRNKYLNGAITAMDYILGRNPNVQSYVTG
YGDNPLENPHHRFWAYQADNSFPQPPAGCMSGGPNSGLQDPWVKSLGWKPGQMAAEKCFV
DNIESWSTNELAINWNAPLAWMSAFLDEEGRTELPPIINLGDVNGDGEKDAIDFALIKKA
LLNGDTSIQNADVNNDGSVDAMDLALYKSFLLGKANF
Download sequence
Identical sequences H2JJD5
WP_014312243.1.10689 gi|376259942|ref|YP_005146662.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]