SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|376261117|ref|YP_005147837.1| from Clostridium sp. BNL1100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|376261117|ref|YP_005147837.1|
Domain Number 1 Region: 310-810
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 6.8e-138
Family Cellulases catalytic domain 0.0000000000397
Further Details:      
 
Domain Number 2 Region: 35-199
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.37e-29
Family CBM4/9 0.0036
Further Details:      
 
Domain Number 3 Region: 212-309
Classification Level Classification E-value
Superfamily E set domains 3.71e-22
Family E-set domains of sugar-utilizing enzymes 0.00047
Further Details:      
 
Domain Number 4 Region: 822-884
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000129
Family Type I dockerin domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|376261117|ref|YP_005147837.1|
Sequence length 885
Comment putative carbohydrate binding protein,dockerin-like protein [Clostridium sp. BNL1100]
Sequence
MKKRLVKKIAMVIAIVLVLSSSIGQAFALVGAGDIIQNHTFDNRVGLPWHVVESYPAKAS
FDITSDGKYKITAEKIGAAGTGERWDIQFRHRGLSLVQGHTYTVQFTVTASRACKIYPKI
GDQGDPYDEYWNMNDQWQFLELQANTPKTVTQTFTQKKGDKSNVEFAFHLAPDKTTSEAQ
NPASFQPITYTFDDIYVKDPQFAGYPDPIPEPTNVVRLNQEGFYPNSDKIATVATSSTTP
INWQLVNSAGTAVLTGKSTVKGADHASGDNVHIIDFSSYKTVGTGYKIVTDVSVTKAGDN
ESMKFNIGNDIYTQMKYDSMKYFYHNRSAIPIEMPYCDQSQWARPAGHTSDILAPDPSRD
YKANYTLDVTGGWYDAGDHGKYVVNGGISTWTVMNAYERALHLGGDMSVAPFKDGSLKIP
ESGNGYPDILDEARYNLKTLLNMQVPAGNELAGMAHHKAHDERWTALAVRPDQDTMKRWL
QPPSTAATLNLAAMAAQGSRLWKQYDSAFATKCLTAAETAWDAAVAHPAIYATMEQGPGG
GAYGDNYVGDDFYWAACELYATTGSDKYLNYIKSSKHYLEMPTELTGGEDNGLTGAFDWG
NTAGMGTITLALVPNKLPATDVAKAKANIQAAADKFITIEKAQGYGVPIEEKVISSPFDQ
STVSGFPWGSNSFVVNEAIVMSYAYEFSNVNGTKNNKYINGAITAMDYILGRNPNVQSYI
TGYGDNPLENPHHRFWSYQANNSFPKPPAGCLSGGPNSGLQDPWVKGSGWQPGVRPAEMC
FMDNIESWSTNEITINWNAPLVWMSAYLAEAGPKIGGTTPPPTDLGDVNADGNKDALDFA
ALKKALLTQDNSTINVANADINKDGAVDAVDFALLKSFLLGKITL
Download sequence
Identical sequences H2JBE7
WP_014313405.1.10689 gi|376261117|ref|YP_005147837.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]