SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|557606997|ref|YP_008774963.1| from Clostridium tetani genome 12124569

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557606997|ref|YP_008774963.1|
Domain Number 1 Region: 2-555
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.93e-199
Family Clostridium neurotoxins, catalytic domain 0.000000000219
Further Details:      
 
Domain Number 2 Region: 559-884
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 1.57e-116
Family Clostridium neurotoxins, "coiled-coil" domain 0.000000162
Further Details:      
 
Domain Number 3 Region: 1112-1314
Classification Level Classification E-value
Superfamily STI-like 9.68e-67
Family Clostridium neurotoxins, C-terminal domain 0.00000000297
Further Details:      
 
Domain Number 4 Region: 882-1096
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.37e-42
Family Clostridium neurotoxins, the second last domain 0.00000000449
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|557606997|ref|YP_008774963.1|
Sequence length 1315
Comment tetanus toxin tetX [Clostridium tetani 12124569]
Sequence
MPITINNFRYSDPVNNDTIIMMEPPYCKGLDIYYKAFKITDRIWIVPERYEFGTKPEDFN
PPSSLIEGASEYYDPNYLRTDSDKDRFLQTMVKLFNRIKNNVAGEALLDKIINAIPYLGN
SYSLLDKFDTNSNSVSFNLSEQDPSGATTKSAMLTNLIIFGPGPVLNKNEVRGIVLRVDN
KNYFPCRDGFGSIMQMAFCPEYIPTFDNVIENITSLTIGKSKYFQDPALLLMHELIHVLH
GLYGMQVSSHEIIPSKQEIYMQHTYPISAEELFTFGGQDANLISIDIKNDLYEKTLNDYK
AIANKLSQVTSCNDPNIDIDSYKQIYQQKYQFDKDSNGQYIVNEDKFQILYNSIMYGFTE
IELGKKFNIKTRLSYFSMNHDPVKIPNLLDDTIYNDTEGFNIESKDLKSEYKGQNMRVNT
NAFRNVDGSGLVSKLIGLCKKIIPPTNIRENLYNRTASLTDLGGELCIKIKNEDLTFIAE
KNSFSEEPFQDETVSYNTKNKPLNFNYSLDKIILDYNLQSKITLPNDRTTPVTKGIPYAP
KYKSNAASTIEIHNIDDNTIYQYLYAQKSPTTLQRITMTNSVDDALINSTKIYSYFPSVI
SKVNQGAQGILFLQWVRDIIDDFTNESSQKTTIDKISDVSTIVPYIGPALNIVKQGYEGN
FIGALETTGVVLLLEYIPEITLPVIAALSIAESSTQKEKIIKTIDNFLEKRYEKWIEVYK
LIKAKWLGTVNTQFQKRSYQMYRSLEYQVDAIKKIIDYEYKIYSGPDKEQIADEINNLKN
KLEEKANKAMININIFMRESSRSFLVNQMINEAKKQLLEFDTQSKNILMQYIKANSKFIG
ITELKKLESKINKVFSTPIPFSYSKNLDCWVDNEEDIDVILKKSTILNLDINNDIISDIS
GFNSSVITYPDAQLVPGINGKAIHLVNNESSEVIVHKAMDIEYNDMFNNFTVSFWLRVPK
VSASHLEQYGTNEYSIISSMKKYSLSIGSGWSVSLKGNNLIWTLKDSAGEVRQITFSDLS
DKFNAYLANKWVFITITNDRLSSANLYINGVLMKNAEITGLGAIREDNNITLKLDRCNNN
NQYVSIDKFRIFCKALNPKEIEKLYTSYLSITFLRDFWGNPLRYDTEYYLIPVASSSKDV
QLKNITDYMYLTNAPSYTNGKLNIYYRRLYSGLKFIIKRYTPNNEIDSFVKSGDFIKLYV
SYNNNEHIVGYPKDGNAFNNLDRILRVGYNAPGIPLYKKMEAVKLRDLKTYSVQLKLYDD
KNASLGLVGIRNGQIGNDPNRDILIASNWYFNHLKDKTLTCDWYFVPTDEGWTND
Download sequence
Identical sequences U6EZX2
gi|557606997|ref|YP_008774963.1| WP_023439719.1.61190 gi|557606997|ref|YP_008774963.1|NC_022778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]