SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385775996|ref|YP_005648564.1| from Sulfolobus islandicus REY15A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385775996|ref|YP_005648564.1|
Domain Number 1 Region: 2-41,164-345
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.65e-23
Family FolH catalytic domain-like 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385775996|ref|YP_005648564.1|
Sequence length 488
Comment aminopeptidase-like protein [Sulfolobus islandicus REY15A]
Sequence
MLLQHLKTLSNYGEIITGSKNEIKLVREIRKMLEDNSDEIRQIPIRVLNWEQKELIFECE
SKTIDAISLPYSLSTEVEADVADNFKECNGRKLMKIRIKNLYEINKLYIEAVENDCLGII
FSLNNEKRKFVIKYGDLLSHQPSYPPPIPAFYIKENDFPYIKGRCRISLKTDINPFATGY
IIEAIRNSKNENKIIHITAHHDHWFKGERDNLLAVALLREFRSNVYETHLISFTAEESGS
LNFSTFSWSHGSREFLKNYKNTDDILLNINMDNISEESLILKAVPGLLELSRKYFKNVVE
SPEIYSDGYSYIKVGIPSITIESLGNIHYHGEYDVIENDKSNAFLNASTILDIINRIINE
NIEYKTREMKEELKKDLVELPAELKSYLVNVEDLLDKNYMEAYREIVKLYGGILELNQPY
STVELFHKIKGLKIARKNDVCIEDLGCIKRLRNDEIFYRFYLYYINELKESITTEYINKI
YFVLKKFF
Download sequence
Identical sequences C3MQ55 C3NHB4 D2PC66 F0NF70 F0NM27
419942.YN1551_1433 429572.LS215_1510 gi|385775996|ref|YP_005648564.1| gi|227830383|ref|YP_002832163.1| gi|229582047|ref|YP_002840446.1| gi|284997889|ref|YP_003419656.1| gi|385773358|ref|YP_005645924.1| WP_012713732.1.27011 WP_012713732.1.34992 WP_012713732.1.52267 WP_012713732.1.66823 WP_012713732.1.67233 WP_012713732.1.91160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]