SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384461196|ref|YP_005673791.1| from Clostridium botulinum F str. 230613

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384461196|ref|YP_005673791.1|
Domain Number 1 Region: 2-532
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.34e-185
Family Clostridium neurotoxins, catalytic domain 0.000000000542
Further Details:      
 
Domain Number 2 Region: 537-867
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 4.45e-126
Family Clostridium neurotoxins, "coiled-coil" domain 0.0000000529
Further Details:      
 
Domain Number 3 Region: 1074-1277
Classification Level Classification E-value
Superfamily STI-like 2.49e-66
Family Clostridium neurotoxins, C-terminal domain 0.00000573
Further Details:      
 
Domain Number 4 Region: 866-1072
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.39e-52
Family Clostridium neurotoxins, the second last domain 0.000000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384461196|ref|YP_005673791.1|
Sequence length 1278
Comment botulinum neurotoxin type F, BoNT/F [Clostridium botulinum F str. 230613]
Sequence
MPVVINSFNYNDPVNDDTILYMQIPYEEKSKKYYKAFEIMRNVWIIPERNTIGTDPSDFD
PPASLENGSSAYYDPNYLTTDAEKDRYLKTTIKLFKRINSNPAGEVLLQEISYAKPYLGN
EHTPINEFHPVTRTTSVNIKSSTNVKSSIILNLLVLGAGPDIFENSSYPVRKLMDSGGVY
DPSNDGFGSINIVTFSPEYEYTFNDISGGYNSSTESFIADPAISLAHELIHALHGLYGAR
GVTYKETIKVKQAPLMIAEKPIRLEEFLTFGGQDLNIITSAMKEKIYNNLLANYEKIATR
LSRVNSAPPEYDINEYKDYFQWKYGLDKNADGSYTVNENKFNEIYKKLYSFTEIDLANKF
KVKCRNTYFIKYGFLKVPNLLDDDIYTVSEGFNIGNLAVNNRGQNIKLNPKIIDSIPDKG
LVEKIVKFCKSVIPRKGTKAPPRLCIRVNNRELFFVASESSYNENDINTPKEIDDTTNLN
NNYRNNLDEVILDYNSETIPQISNQTLNTLVQDDSYVPRYDSNGTSEIEEHNVVDLNVFF
YLHAQKVPEGETNISLTSSIDTALSEESQVYTFFSSEFINTINKPVHAALFISWINQVIR
DFTTEATQKSTFDKIADISLVVPYVGLALNIGNEVQKENFKEAFELLGAGILLEFVPELL
IPTILVFTIKSFIGSSENKNKIIKAINNSLMERETKWKEIYSWIVSNWLTRINTQFNKRK
EQMYQALQNQVDAIKTVIEYKYNNYTSDERNRLESEYNINNIREELNKKVSLAMENIERF
ITESSIFYLMKLINEAKVSKLREYDEGVKEYLLDYISEHRSILGNSVQELNDLVTSTLNN
SIPFELSSYTNDKILILYFNKLYKKIKDNSILDMRYENNKFIDISGYGSNISINGDVYIY
STNRNQFGIYSSKPSEVNIAQNNDIIYNGRYQNFSISFWVRIPKYFNKVNLNNEYTIIDC
IRNNNSGWKISLNYNKIIWTLQDTAGNNQKLVFNYTQMISISDYINKWIFVTITNNRLGN
SRIYINGNLIDEKSISNLGDIHVSDNILFKIVGCNDTRYVGIRYFKVFDTELGKTEIETL
YSDEPDPSILKDFWGNYLLYNKRYYLLNLLRTDKSITQNSNFLNINQQRGVYQKPNIFSN
TRLYTGVEVIIRKNGSTDISNTDNFVRKNDLAYINVVDRDVEYRLYADISIAKPEKIIKL
IRTSNSNNSLGQIIVMDSIGNNCTMNFQNNNGGNIGLLGFHSNNLVASSWYYNNIRKNTS
SNGCFWSFISKEHGWQEN
Download sequence
Identical sequences A7GBG3 Q57236
gi|384461196|ref|YP_005673791.1| gi|153939808|ref|YP_001390123.1| WP_011987710.1.24613 WP_011987710.1.68062 WP_011987710.1.82254 WP_011987710.1.96435 441772.CLI_0851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]