SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384460819|ref|YP_005673414.1| from Clostridium botulinum F str. 230613

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384460819|ref|YP_005673414.1|
Domain Number 1 Region: 468-565
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000942
Family Collagen-binding domain 0.002
Further Details:      
 
Domain Number 2 Region: 348-444
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000262
Family Collagen-binding domain 0.0023
Further Details:      
 
Weak hits

Sequence:  gi|384460819|ref|YP_005673414.1|
Domain Number - Region: 256-337
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00575
Family Collagen-binding domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384460819|ref|YP_005673414.1|
Sequence length 579
Comment N-acetylmuramoyl-L-alanine amidase [Clostridium botulinum F str. 230613]
Sequence
MNDNAKDQLKKLDTKEVIIVGGPGSISEDIATELKNLGIKVNRIYGEDRYKTSLKIAKEI
GVKNGVVVTNGLGFADALAMAPIAASKQMPILLTPSDKLTSDTMEFLTKSSYNKSYVLGG
TATVSDYIKNSLKNPTRLSGDDRYKTNIAILSHFKQDLNLNEVYITSGDGYADALSGSVL
ASKNKSPIILINDNLNKSTKDFVSTNKFDFKNVTIFGGEGVVKEPTISSLFGAFRSGETR
SDTKEVVAERWDRSYLKDYHIDLPKEGKLDIEYDFNDFTRFDLIVLDKKGNEIIKKSYNY
LNKNKSIHDNYNDIRLPKGSYIVRVHAFNMNGTYTIKAKYTQEGEGFEKEFNNDIKTANL
IEPNKSIIGSIHSYNDVDYYKFTLNEKGSLKINLKHNQYGRYGFRVSLLDENNKSITEFI
SGGEDINSYSNKLRLAKGTYFVKIECEKWNDEPLQYELNLVYNIEGENYESEPNDYIQDA
NYIKCNKEYIGNIQSRDDRDYYKINLNSDSKITINFKHDEGYGKWTILLCDKDNNPIRRF
KSYGYEINKDFGPIELKEGEYYVSIEGKDDLDYTINILK
Download sequence
Identical sequences gi|384460819|ref|YP_005673414.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]